Protein detail
SORT
Sortilin (100 kDa NT receptor) (Glycoprotein 95) (Gp95) (Neurotensin receptor 3) (NT3) (NTR3)
Protein symbol SORT | UniProt ID | EVMP score 0.38 |
Frequency 1 | Transmembrane count 1 | Protein classification Disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Sortilin (100 kDa NT receptor) (Glycoprotein 95) (Gp95) (Neurotensin receptor 3) (NT3) (NTR3)
Protein Class
Disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function
- Disease related genes
- Transporters
- Predicted intracellular proteins
- Potential drug targets
Transmembrane
756..778; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym
Gp95NT3
Gene Description
Sortilin 1
Chromosome
1
Position
109309568-109397918
Frequency
1
EVMP Score
0.38
Fluorescence & Localization
Tissue SpecificliverCell SpecificHepatocytesSingle-Nuclei Brain Specifichippocampal CA1-3Blood Cell Specificclassical monocyteBlood Lineage Specificdendritic cells
Function & Pathway
Protein Function
- Disease related genes
- Transporters
- Predicted intracellular proteins
- Potential drug targets
Cellular Component
- GO:0005764 lysosome
- GO:0005765 lysosomal membrane
- GO:0005769 early endosome
- GO:0005789 endoplasmic reticulum membrane
- GO:0005794 Golgi apparatus
- GO:0005829 cytosol
- GO:0005886 plasma membrane
- GO:0005905 clathrin-coated pit
- GO:0009986 cell surface
- GO:0010008 endosome membrane
- GO:0016020 membrane
- GO:0030136 clathrin-coated vesicle
- GO:0030140 trans-Golgi network transport vesicle
- GO:0031410 cytoplasmic vesicle
- GO:0031965 nuclear membrane
- GO:0032580 Golgi cisterna membrane
- GO:0048471 perinuclear region of cytoplasm
- GO:0150053 cerebellar climbing fiber to Purkinje cell synapse
Molecular Function
Biological Process
KEGG
Reactome
Mediation Categories
Clinical-translation mediationFusion and delivery mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
Ligand-Receptor Signaling
33 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | Cellinker | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | CSPA | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | HPMR | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | No | No | No | Yes | No |
| cell_surface | cell_surface | Surfaceome | No | No | No | Yes | No |
| cell_surface | cell_surface | connectomeDB2020 | No | No | No | Yes | No |
| cell_surface | cell_surface | OmniPath | No | No | No | Yes | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | No | Yes | No |
Regulatory Interaction Network
7 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| PAK1 | Q13153 | SORT | Q99523 | Yes | No | Yes | SIGNOR | SIGNOR:31767632 |
| COMPLEX:O43747_P61966_Q10567_Q9BXS5 | SORT | Q99523 | Yes | Yes | No | SIGNOR | SIGNOR:31767632 | |
| PAK3 | O75914 | SORT | Q99523 | Yes | No | Yes | SIGNOR | SIGNOR:31767632 |
| PAK2 | Q13177 | SORT | Q99523 | Yes | No | Yes | SIGNORPhosphoSitePhosphoSite_ProtMapperProtMapper | SIGNOR:31767632PhosphoSite:25805502PhosphoSite:31767632 |
| SORT | Q99523 | APOA1 | P02647 | Yes | Yes | No | SIGNOR | SIGNOR:23283348 |
| SORT | Q99523 | APOE | P02649 | Yes | Yes | No | SIGNOR | SIGNOR:23283348 |
| CSK2B | P67870 | SORT | Q99523 | Yes | Yes | No | iPTMnetPhosphoSite_norefSIGNORProtMapperPhosphoSite_ProtMapper | SIGNOR:25805502 |
Protein Complex Composition
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometryMass spectrometry [LTQ-FT Ultra] | 1 | 37714423 |
Sequence, Structure & Domains
Sequences
Length
831
Mass
92,068
Sequence
MERPWGAADGLSRWPHGLGLLLLLQLLPPSTLSQDRLDAPPPPAAPLPRWSGPIGVSWGLRAAAAGGAFPRGGRWRRSAPGEDEECGRVRDFVAKLANNTHQHVFDDLRGSVSLSWVGDSTGVILVLTTFHVPLVIMTFGQSKLYRSEDYGKNFKDITDLINNTFIRTEFGMAIGPENSGKVVLTAEVSGGSRGGRIFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTIGVKIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRWTHLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMAPLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNSVPIILAIVGLMLVTVVAGVLIVKKYVCGGRFLVHRYSVLQQHAEANGVDGVDALDTASHTNKSGYHDDSDEDLLE
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q99523-1; Sequence=Displayed; Name=2; IsoId=Q99523-2; Sequence=VSP_046239, VSP_046240
Alternative Sequence
1..136; Missing (in isoform 2); 278..279; KA -> T (in isoform 2)
3D Structural Models
Turn
177..179; 277..282; 333..335; 397..399; 449..451; 576..578; 630..633
Helix
92..97; 135..137; 158..161; 168..170; 263..265; 465..469; 529..531; 591..593; 604..606; 614..616; 670..672; 696..704; 707..710; 737..740; 741..743
Beta Strand
100..106; 110..116; 118..121; 124..130; 141..149; 152..154; 163..167; 172..174; 182..186; 187..190; 196..202; 208..211; 216..218; 221..223; 226..234; 239..244; 247..261; 267..271; 273..275; 283..291; 297..309; 312..318; 320..323; 325..332; 351..356; 361..366; 368..370; 372..379; 381..383; 385..395; 405..410; 414..419; 421..423; 425..432; 438..441; 446..448; 453..456; 459..462; 482..484; 488..497; 504..510; 516..521; 523..528; 533..538; 540..542; 546..552; 558..561; 567..573; 581..590; 595..603; 617..621; 638..645; 661..665; 673..675; 683..685; 714..717; 724..726; 734..736
3D Structure
X-ray crystallography (14)
Domain & Motif Annotations
Repeat
145..156; BNR 1; 198..209; BNR 2; 240..251; BNR 3; 287..298; BNR 4; 328..339; BNR 5; 377..388; BNR 6; 428..439; BNR 7; 506..517; BNR 8; 548..559; BNR 9
Motif
787..792; Endocytosis signal; 826..830; DXXLL motif involved in the interaction with GGA1
Domain (CC)
The N-terminal propeptide may facilitate precursor transport within the Golgi stack. Intrachain binding of the N-terminal propeptide and the extracellular domain may also inhibit premature ligand binding.; DOMAIN: The extracellular domain may be shed following protease cleavage in some cell types.
Domain (FT)
98..742; Vps10p
Region
50..61; Intrachain binding of the propeptide and the extracellular domain; 98..604; 10-bladed beta-propeller; 612..756; Interactions with LRPAP1 and NGFB; 612..666; 10CCa cysteine-knot; 668..742; 10CCb cysteine-knot; 779..831; Golgi to endosome transport and interactions with GGA1 and GGA2
Protein Families
- VPS10-related sortilin family
- SORT1 subfamily
Sequence Similarities
Belongs to the VPS10-related sortilin family. SORT1 subfamily.
Clinical Relevance
Biomarker
Phase 3; Phase 2; Phase 1
Drugs
Interaction Protein
ENSG00000100083ENSG00000103365ENSG00000123374ENSG00000134259ENSG00000140538ENSG00000163956ENSG00000198400
Interaction Count
7
Interaction Dataset
intact_biogrid