Protein detail
P2RX4
P2X purinoceptor 4 (P2X4) (ATP receptor) (Purinergic receptor)
Entry name P2RX4 | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 4 | Transmembrane count 2 | Protein classification FDA approved drug targetsPredicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
P2X purinoceptor 4 (P2X4) (ATP receptor) (Purinergic receptor)
Protein Class (3)
FDA approved drug targetsPredicted membrane proteinsTransporters
Protein Function (2)
- Transporters:Transporter channels and pores
- FDA approved drug targets:Small molecule drugs
Transmembrane
34..54; Helical; Name=1; 339..359; Helical; Name=2
Transmembrane Count
2
Ensembl
Entrez Gene Symbol
Gene Synonym
P2X4
Gene Description
Purinergic receptor P2X 4
Chromosome
12
Position
121210065-121234106
Supporting publications (n)
4
EVMP confidence score
0.40
Fluorescence & Localization
Tissue Specificparathyroid glandCell SpecificEndometrial glandular cellsSingle-Nuclei Brain Specificendothelial cell
Function & Pathway
Protein Function (2)
- Transporters:Transporter channels and pores
- FDA approved drug targets:Small molecule drugs
Cellular Component (13)
- GO:0005765 lysosomal membrane
- GO:0005886 plasma membrane
- GO:0016020 membrane
- GO:0030054 cell junction
- GO:0043025 neuronal cell body
- GO:0043195 terminal bouton
- GO:0043197 dendritic spine
- GO:0044297 cell body
- GO:0048471 perinuclear region of cytoplasm
- GO:0070062 extracellular exosome
Page 1 of 2
Molecular Function (10)
- GO:0001614 purinergic nucleotide receptor activity
- GO:0004931 extracellularly ATP-gated monoatomic cation channel activity
- GO:0005102 signaling receptor binding
- GO:0005507 copper ion binding
- GO:0005515 protein binding
- GO:0005524 ATP binding
- GO:0008270 zinc ion binding
- GO:0042802 identical protein binding
- GO:0045296 cadherin binding
- GO:0099604 ligand-gated calcium channel activity
Biological Process (3)
KEGG (3)
Reactome (7)
Mediation Categories (4)
Clinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence38
Ligand-Receptor Signaling (34)
34 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| ion_channel | ion_channel | Almen2009 | Yes | ||||
| atp_gated | ion_channel | Almen2009 | Yes | ||||
| ligand_gated | ion_channel | Almen2009 | Yes | ||||
| atp_gated | ion_channel | Surfaceome | Yes | ||||
| ligand_gated | ion_channel | Surfaceome | Yes | ||||
| transporter | transporter | OmniPath | Yes | ||||
| ion_channel | ion_channel | OmniPath | Yes | ||||
| transmembrane | transmembrane | UniProt_location | |||||
| transmembrane | transmembrane | UniProt_topology | |||||
| transmembrane | transmembrane | UniProt_keyword |
Protein Complex Composition (3)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Size Exclusion Chromatography | Mass spectrometryWestern blotting | 1 | 34265469 |
Sequence, Structure & Domains
Sequences
Length
388
Mass
43,369
Sequence
MAGCCAALAAFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTDPFCPIFRLGKIVENAGHSFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYCMKKRLYYREKKYKYVEDYEQGLASELDQ
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q99571-1; Sequence=Displayed; Name=2; IsoId=Q99571-2; Sequence=VSP_053812; Name=3; IsoId=Q99571-3; Sequence=VSP_053813
Alternative Sequence
45; G -> GCYHPHLAEVEMESPRR (in isoform 2); 149..175; Missing (in isoform 3)
3D Structural Models
Turn
77..79; 122..124; 138..140; 196..199; 221..223
Helix
4..12; 26..45; 46..50; 86..89; 180..184; 211..214; 232..238; 243..247; 267..269; 332..345; 347..359; 364..371
Beta Strand
13..18; 20..24; 55..59; 61..69; 72..76; 80..84; 90..93; 96..117; 127..129; 142..155; 157..166; 186..195; 200..205; 229..231; 251..258; 273..278; 284..286; 293..301; 307..324; 326..330; 372..375
3D Structure
Electron microscopy (3)
Domain & Motif Annotations
Protein Families
P2X receptor family
Sequence Similarities
Belongs to the P2X receptor family.
Clinical Relevance
Supporting Publications4
| PMID | Title | Related sentences |
|---|---|---|
| 33580265 | Proteomic Profile of Urinary Extracellular Vesicles Identifies AGP1 as a Potential Biomarker of Primary Aldosteronism. | No related sentences available |
| 38164498 | Enrichment of sweat-derived extracellular vesicles of human and bacterial origin for biomarker identification. | No related sentences available |
| 38225453 | Deep proteomic analysis of obstetric antiphospholipid syndrome by DIA-MS of extracellular vesicle enriched fractions. | No related sentences available |
| 38731868 | The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer. | No related sentences available |