Protein detail
P2RX7
P2X purinoceptor 7 (P2X7) (ATP receptor) (P2Z receptor) (Purinergic receptor)
Entry name P2RX7 | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 1 | Transmembrane count 2 | Protein classification Predicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
P2X purinoceptor 7 (P2X7) (ATP receptor) (P2Z receptor) (Purinergic receptor)
Protein Class (2)
Predicted membrane proteinsTransporters
Protein Function
Transporters:Transporter channels and pores
Transmembrane
23..46; Helical; Name=1; 329..353; Helical; Name=2
Transmembrane Count
2
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
MGC20089P2X7
Gene Description
Purinergic receptor P2X 7
Chromosome
12
Position
121132819-121188032
Supporting publications (n)
1
EVMP confidence score
0.40
Function & Pathway
Protein Function
Transporters:Transporter channels and pores
Cellular Component (11)
- GO:0005737 cytoplasm
- GO:0005739 mitochondrion
- GO:0005886 plasma membrane
- GO:0005911 cell-cell junction
- GO:0009897 external side of plasma membrane
- GO:0016020 membrane
- GO:0031594 neuromuscular junction
- GO:0032059 bleb
- GO:0043025 neuronal cell body
- GO:0098793 presynapse
Page 1 of 2
Molecular Function (7)
Biological Process (3)
KEGG (3)
Reactome (14)
- R-hsa-9855142 cellular responses to mechanical stimuli
- R-hsa-8953897 cellular responses to stimuli
- R-hsa-139853 elevation of cytosolic ca2 levels
- R-hsa-109582 hemostasis
- R-hsa-5663205 infectious disease
- R-hsa-622312 inflammasomes
- R-hsa-168249 innate immune system
- R-hsa-9658195 leishmania infection
- R-hsa-9856532 mechanical load activates signaling by piezo1 and integrins in osteocytes
- R-hsa-168643 nucleotide binding domain leucine rich repeat containing receptor nlr signaling pathways
Page 1 of 2
Mediation Categories (5)
Clinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence44
Ligand-Receptor Signaling (43)
43 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | CSPA | Yes | ||||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | Yes | ||||
| cell_surface | cell_surface | Surfaceome | Yes | ||||
| cell_surface | cell_surface | OmniPath | Yes | ||||
| receptor | receptor | Cellinker | Yes | Yes | |||
| receptor | receptor | scConnect | Yes | Yes | |||
| receptor | receptor | iTALK | Yes | Yes | |||
| receptor | receptor | CellCellInteractions | Yes | Yes | |||
| receptor | receptor | EMBRACE | Yes | Yes | |||
| p2x_purinergic | receptor | HGNC | Yes | Yes |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry | 1 | 40689422 |
Sequence, Structure & Domains
Sequences
Length
595
Mass
68,585
Sequence
MPACCSCSDVFQYETNKVTRIQSMNYGTIKWFFHVIIFSYVCFALVSDKLYQRKEPVISSVHTKVKGIAEVKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCPEYPTRRTLCSSDRGCKKGWMDPQSKGIQTGRCVVYEGNQKTCEVSAWCPIEAVEEAPRPALLNSAENFTVLIKNNIDFPGHNYTTRNILPGLNITCTFHKTQNPQCPIFRLGDIFRETGDNFSDVAIQGGIMGIEIYWDCNLDRWFHHCRPKYSFRRLDDKTTNVSLYPGYNFRYAKYYKENNVEKRTLIKVFGIRFDILVFGTGGKFDIIQLVVYIGSTLSYFGLAAVFIDFLIDTYSSNCCRSHIYPWCKCCQPCVVNEYYYRKKCESIVEPKPTLKYVSFVDESHIRMVNQQLLGRSLQDVKGQEVPRPAMDFTDLSRLPLALHDTPPIPGQPEEIQLLRKEATPRSRDSPVWCQCGSCLPSQLPESHRCLEELCCRKKPGACITTSELFRKLVLSRHVLQFLLLYQEPLLALDVDSTNSRLRHCAYRCYATWRFGSQDMADFAILPSCCRWRIRKEFPKSEGQYSGFKSPY
Alternative Products
Event=Alternative splicing; Named isoforms=9; Name=A; IsoId=Q99572-1; Sequence=Displayed; Name=B; Synonyms=Delta-C, cytoplasmic tail deleted; IsoId=Q99572-2; Sequence=VSP_047784, VSP_047785; Name=C; IsoId=Q99572-3; Sequence=VSP_047781, VSP_047782; Name=D; IsoId=Q99572-4; Sequence=VSP_047777, VSP_047780; Name=E; IsoId=Q99572-5; Sequence=VSP_047783, VSP_047784, VSP_047785; Name=F; IsoId=Q99572-6; Sequence=VSP_047778, VSP_047779; Name=G; IsoId=Q99572-7; Sequence=VSP_047776, VSP_047784, VSP_047785; Name=H; Synonyms=Delta-TM1; IsoId=Q99572-8; Sequence=VSP_047776; Name=J; Synonyms=Isoform P; IsoId=Q99572-9; Sequence=VSP_062514, VSP_062515
Alternative Sequence
1..98; MPACCSCSDVFQYETNKVTRIQSMNYGTIKWFFHVIIFSYVCFALVSDKLYQRKEPVISSVHTKVKGIAEVKEEIVENGVKKLVHSVFDTADYTFPLQ -> MTPGDHSW (in isoform G and isoform H); 1..7; MPACCSC -> MDGPAEQ (in isoform D); 1..3; MPA -> MWQ (in isoform F); 4..292; Missing (in isoform F); 8..177; Missing (in isoform D); 122..128; YPTRRTL -> EFRPEGV (in isoform C); 129..595; Missing (in isoform C); 206..294; Missing (in isoform E); 249..258; GGIMGIEIYW -> IRQVLQGKQC (in isoform J); 259..595; Missing (in isoform J); 347..364; AAVFIDFLIDTYSSNCCR -> VRDSLFHALGKWFGEGSD (in isoform B, isoform E and isoform G); 365..595; Missing (in isoform B, isoform E and isoform G)
Domain & Motif Annotations
Domain (CC)
Contains two P2RX7-specific cytoplasmic domains, the C-cysteines (C-cys) anchor and the cytoplasmic ballast. Palmitoylation of the cytoplasmic C-cys anchor prevents receptor desensitization. The cytoplasmic ballast contains a zinc ion complex and a guanosine nucleotide binding site.; DOMAIN: The ion selectivity is determined by two sequential filters: a dynamic tri-Ser-342 size filter and three conformationally static cation filters.
Region
360..377; C-cys anchor; 395..595; Cytoplasmic ballast
Protein Families
P2X receptor family
Sequence Similarities
Belongs to the P2X receptor family.
Clinical Relevance
Related Diseases (13)
Biomarker
Phase 1/2; Phase 2; Phase 1; Investigative; Phase 2/3
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 32795414 | Extracellular Vesicle and Particle Biomarkers Define Multiple Human Cancers. | Among traditional exosome markers, CD9, HSPA8, ALIX, and HSP90AB1 represent pan-EVP markers, while ACTB, MSN, and RAP1B are novel pan-EVP markers. |