Protein detail
LPAR4
Lysophosphatidic acid receptor 4 (LPA receptor 4) (LPA-4) (G-protein coupled receptor 23) (P2Y purinoceptor 9) (P2Y9) (P2Y5-like receptor) (Purinergic receptor 9)
Entry name LPAR4 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count 7 | Protein classification G-protein coupled receptorsPredicted intracellular proteinsPredicted membrane proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Lysophosphatidic acid receptor 4 (LPA receptor 4) (LPA-4) (G-protein coupled receptor 23) (P2Y purinoceptor 9) (P2Y9) (P2Y5-like receptor) (Purinergic receptor 9)
Protein Class (4)
G-protein coupled receptorsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function (4)
- G-protein coupled receptors:Lysolipids receptors
- Transporters
- Predicted intracellular proteins
- G-protein coupled receptors:GPCRs excl olfactory receptors
Transmembrane
44..64; Helical; Name=1; 74..94; Helical; Name=2; 113..133; Helical; Name=3; 156..176; Helical; Name=4; 204..224; Helical; Name=5; 255..275; Helical; Name=6; 295..315; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
GPR23LPA4P2RY9P2Y5-LIKEP2Y9
Gene Description
Lysophosphatidic acid receptor 4
Chromosome
X
Position
78747709-78758714
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization1
Function & Pathway7
Protein Function (4)
- G-protein coupled receptors:Lysolipids receptors
- Transporters
- Predicted intracellular proteins
- G-protein coupled receptors:GPCRs excl olfactory receptors
Cellular Component (3)
Molecular Function (2)
Biological Process (3)
KEGG (7)
- hsa04015 Rap1 signaling pathway
- KEGG:hsa04072 Phospholipase D signaling pathway
- KEGG:hsa04080 Neuroactive ligand-receptor interaction
- KEGG:hsa04151 PI3K-Akt signaling pathway
- KEGG:hsa04810 Regulation of actin cytoskeleton
- KEGG:hsa05130 Pathogenic Escherichia coli infection
- KEGG:hsa05200 Pathways in cancer
Reactome (6)
Mediation Categories
Receptor-signaling mediation
Relations & Evidence66
Ligand-Receptor Signaling (53)
53 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| gpcr | receptor | GPCRdb | No | Yes | No | Yes | No |
| lysophosphatidic_acid | receptor | HGNC | No | Yes | No | Yes | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | No | Yes | No |
Page 6 of 6Previous
Regulatory Interaction Network (11)
11 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| LPAR4 | Q99677 | GNAO | P09471 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
Page 2 of 2Previous
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometryWestern blottingMass spectrometry|Western blottingMass spectrometry [LTQ-FT Ultra] | 1 | 22329422 |
Sequence, Structure & Domains5
Sequences
Length
370
Mass
41,895
Sequence
MGDRRFIDFQFQDSNSSLRPRLGNATANNTCIVDDSFKYNLNGAVYSVVFILGLITNSVSLFVFCFRMKMRSETAIFITNLAVSDLLFVCTLPFKIFYNFNRHWPFGDTLCKISGTAFLTNIYGSMLFLTCISVDRFLAIVYPFRSRTIRTRRNSAIVCAGVWILVLSGGISASLFSTTNVNNATTTCFEGFSKRVWKTYLSKITIFIEVVGFIIPLILNVSCSSVVLRTLRKPATLSQIGTNKKKVLKMITVHMAVFVVCFVPYNSVLFLYALVRSQAITNCFLERFAKIMYPITLCLATLNCCFDPFIYYFTLESFQKSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELMLESTF
Domain & Motif Annotations
Protein Families
G-protein coupled receptor 1 family
Sequence Similarities
Belongs to the G-protein coupled receptor 1 family.
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 40326690 | Rapid Identification of Esophageal Squamous Cell Carcinoma Biomarkers by MALDI-TOF MS Fingerprinting of Extracellular Vesicles. | No abstract available |