Protein detail
SNAG
Gamma-soluble NSF attachment protein (SNAP-gamma) (N-ethylmaleimide-sensitive factor attachment protein gamma)
Entry name SNAG | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Essential proteinsPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information10
Protein Names
Gamma-soluble NSF attachment protein (SNAP-gamma) (N-ethylmaleimide-sensitive factor attachment protein gamma)
Protein Class (2)
Essential proteinsPredicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Description
NSF attachment protein gamma
Chromosome
18
Position
10525905-10552764
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization2
Tissue SpecificintestineCell SpecificHepatocytes
Function & Pathway6
Protein Function
Predicted intracellular proteins
Cellular Component (5)
Molecular Function (3)
Biological Process (3)
Reactome (13)
- R-hsa-446203 asparagine n linked glycosylation
- R-hsa-204005 copii mediated vesicle transport
- R-hsa-6811434 copi dependent golgi to er retrograde traffic
- R-hsa-6807878 copi mediated anterograde transport
- R-hsa-199977 er to golgi anterograde transport
- R-hsa-8856688 golgi to er retrograde transport
- R-hsa-6811442 intra golgi and retrograde golgi to er traffic
- R-hsa-6811438 intra golgi traffic
- R-hsa-199991 membrane trafficking
- R-hsa-597592 post translational protein modification
Page 1 of 2
Mediation Categories (2)
Fusion and delivery mediationMetabolism mediation
Relations & Evidence9
Enzyme-Mediated Modification (2)
2 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| NAPG | IGF1R | P08069 | Y | 307 | phosphorylation | KEA | KEA:17570479 |
| NAPG | SRC | P12931 | Y | 307 | phosphorylation | KEA | KEA:17570479 |
Ligand-Receptor Signaling (5)
5 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Sequence, Structure & Domains9
Sequences
Length
312
Mass
34,746
Sequence
MAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRALFHAAKAYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIENVDPEKAVQLYQQTANVFENEERLRQAVELLGKASRLLVRGRRFDEAALSIQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDYVAAERCVRESYSIPGFNGSEDCAALEQLLEGYDQQDQDQVSDVCNSPLFKYMDNDYAKLGLSLVVPGGGIKKKSPATPQAKPDGVTATAADEEEDEYSGGLC
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q99747-1; Sequence=Displayed; Name=2; IsoId=Q99747-2; Sequence=VSP_056355
Alternative Sequence
1..82; Missing (in isoform 2)
Domain & Motif Annotations
Compositional Bias
300..312; Acidic residues
Region
281..312; Disordered
Protein Families
SNAP family
Sequence Similarities
Belongs to the SNAP family.
Clinical Relevance4
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 38731868 | The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer. | No abstract available |