Protein detail

PI51A

Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha (PIP5K1-alpha) (PtdIns(4)P-5-kinase 1 alpha) (EC 2.7.1.68) (68 kDa type I phosphatidylinositol 4-phosphate 5-kinase alpha) (Phosphatidylinositol 4-phosphate 5-kinase type I alpha) (PIP5KIalpha)

Entry name PI51A	UniProt ID Q99755	EVMP score 0.50
Frequency 1	Transmembrane count	Protein classification Cancer-related genesEnzymesEssential proteinsMetabolic proteinsPredicted intracellular proteins

EVMP score: annotation confidence score.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information

Protein Names

Protein Class

Cancer-related genesEnzymesEssential proteinsMetabolic proteinsPredicted intracellular proteins

Protein Function

ENZYME proteins:Transferases
Cancer-related genes:Mutational cancer driver genes
Enzymes
Predicted intracellular proteins

Ensembl

ENSG00000143398

Entrez Gene Symbol

PIP5K1A

Gene Description

Phosphatidylinositol-4-phosphate 5-kinase type 1 alpha

Chromosome

Position

151197949-151249536

Frequency

EVMP Score

0.50

Fluorescence & Localization

Tissue SpecificbrainCell SpecificChoroid plexus epithelial cellsSingle-Nuclei Brain Specificoligodendrocyte

Function & Pathway

Protein Function

ENZYME proteins:Transferases
Cancer-related genes:Mutational cancer driver genes
Enzymes
Predicted intracellular proteins

Cellular Component

Molecular Function

Biological Process

KEGG

Reactome

Mediation Categories

Adhesion and uptake mediationImmune mediationMetabolism mediationReceptor-signaling mediation

Relations & Evidence

Enzyme-Mediated Modification

1 record.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
PIP5K1A	CASP3	P42574	D	279	cleavage	HPRD	HPRD:11042212

Ligand-Receptor Signaling

9 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
receptor	receptor	OmniPath	No	Yes	No	No	No
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
plasma_membrane	plasma_membrane	UniProt_location	No	No	No	No	No
plasma_membrane	plasma_membrane	OmniPath	No	No	No	No	No
receptor	receptor	scConnect	No	Yes	No	No	No

Regulatory Interaction Network

1 record.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
DVL3	Q92997	PI51A	Q99755	Yes	Yes	No	SIGNORSignaLink3	SignaLink3:18772438 SignaLink3:23331499 SIGNOR:18772438

Protein Complex Composition

9 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
mRNA cleavage and polyadenylation specificity factor complex	CPSF1 CPSF2 CPSF3 CPSF4 CSNK1A1 CSTF2 FIP1L1 PIP5K1A TUT1	O95639 P33240 P48729 Q10570 Q6UN15 Q99755 Q9H6E5 Q9P2I0 Q9UKF6	1:1:1:1:1:1:1:1:1	Compleat	Compleat:HC2438	18305108
	NRXN3 PIP5K1A PIP5K1C RABGGTB	O60331 P53611 Q99755 Q9HDB5	0:0:0:0	hu.MAP
	NRXN3 PIP5K1A PIP5K1C RABGGTB	O60331 P53611 Q99755 Q9Y4C0	0:0:0:0	hu.MAP
	NRXN3 PIP5K1A PIP5K1C TRIM41	O60331 Q8WV44 Q99755 Q9HDB5	0:0:0:0	hu.MAP
	NRXN3 PIP5K1A PIP5K1C TRIM41	O60331 Q8WV44 Q99755 Q9Y4C0	0:0:0:0	hu.MAP
	PIP5K1A PIP5K1C	O60331 Q99755	0:0	hu.MAP2
	NRXN3 PIP5K1A PIP5K1C	O60331 Q99755 Q9HDB5	0:0:0	hu.MAP2
	NRXN3 PIP5K1A PIP5K1C	O60331 Q99755 Q9Y4C0	0:0:0	hu.MAP2
	CSNK1A1 PIP5K1A	P48729 Q99755	0:0	Havugimana2012	Havugimana2012:C_80

Isolation & Detection Technology

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Small R sequencing (Illumi HiSeq 2000 (Solexa)R Sequencing	2	34265469 36573687

Sequence, Structure & Domains

Sequences

Length

562

Mass

62,633

Sequence

MASASSGPSSSVGFSSFDPAVPSCTLSSAASGIKRPMASEVLEARQDSYISLVPYASGMPIKKIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESIFFPSEGSNLTPAHHYNDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELCSSGASGSLFYVSSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPRSVKMHIKYDLKGSTYKRRASQKEREKPLPTFKDLDFLQDIPDGLFLDADMYNALCKTLQRDCLVLQSFKIMDYSLLMSIHNIDHAQREPLSSETQYSVDTRRPAPQKALYSTAMESIQGEARRGGTMETDDHMGGIPARNSKGERLLLYIGIIDILQSYRFVKKLEHSWKALVHDGDTVSVHRPGFYAERFQRFMCNTVFKKIPLKPSPSKKFRSGSSFSRRAGSSGNSCITYQPSVSGEHKAQVTTKAEVEPGVHLGRPDVLPQTPPLEEISEGSPIPDPSFSPLVGETLQMLTTSTTLEKLEVAESEFTH

Alternative Products

Event=Alternative splicing; Named isoforms=4; Name=1; Synonyms=PIP5KIalpha2; IsoId=Q99755-1; Sequence=Displayed; Name=2; Synonyms=PIP5KIalpha3; IsoId=Q99755-2; Sequence=VSP_016007, VSP_016008; Name=3; Synonyms=PIP5KIalpha1; IsoId=Q99755-3; Sequence=VSP_016007; Name=4; IsoId=Q99755-4; Sequence=VSP_041912, VSP_041913

Alternative Sequence

30..52; ASGIKRPMASEVLEARQDSYISL -> SGIKRPMASE (in isoform 2 and isoform 3); 41..52; Missing (in isoform 4); 382..410; HMGGIPARNSKGERLLLYIGIIDILQSYR -> Q (in isoform 4); 455..504; LKPSPSKKFRSGSSFSRRAGSSGNSCITYQPSVSGEHKAQVTTKAEVEPG -> C (in isoform 2)

3D Structural Models

Domain & Motif Annotations

Domain (FT)

81..449; PIPK

Region

506..526; Disordered

Clinical Relevance

Disease Involvement

Cancer-related genes

Antibody

HPA029366

Interaction Protein

ENSG00000133703

Interaction Count

Interaction Dataset

intact_biogrid