Protein detail
PI51A
Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha (PIP5K1-alpha) (PtdIns(4)P-5-kinase 1 alpha) (EC 2.7.1.68) (68 kDa type I phosphatidylinositol 4-phosphate 5-kinase alpha) (Phosphatidylinositol 4-phosphate 5-kinase type I alpha) (PIP5KIalpha)
Entry name PI51A | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Cancer-related genesEnzymesEssential proteinsMetabolic proteinsPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha (PIP5K1-alpha) (PtdIns(4)P-5-kinase 1 alpha) (EC 2.7.1.68) (68 kDa type I phosphatidylinositol 4-phosphate 5-kinase alpha) (Phosphatidylinositol 4-phosphate 5-kinase type I alpha) (PIP5KIalpha)
Protein Class (5)
Cancer-related genesEnzymesEssential proteinsMetabolic proteinsPredicted intracellular proteins
Protein Function (4)
- ENZYME proteins:Transferases
- Cancer-related genes:Mutational cancer driver genes
- Enzymes
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Description
Phosphatidylinositol-4-phosphate 5-kinase type 1 alpha
Chromosome
1
Position
151197949-151249536
Supporting publications (n)
1
EVMP confidence score
0.40
Fluorescence & Localization
Tissue SpecificbrainCell SpecificChoroid plexus epithelial cellsSingle-Nuclei Brain Specificoligodendrocyte
Function & Pathway
Protein Function (4)
- ENZYME proteins:Transferases
- Cancer-related genes:Mutational cancer driver genes
- Enzymes
- Predicted intracellular proteins
Cellular Component (9)
Molecular Function (7)
Biological Process (3)
KEGG (10)
- hsa00562 Inositol phosphate metabolism
- KEGG:hsa01100 Metabolic pathways
- KEGG:hsa04070 Phosphatidylinositol signaling system
- KEGG:hsa04072 Phospholipase D signaling pathway
- KEGG:hsa04144 Endocytosis
- KEGG:hsa04510 Focal adhesion
- KEGG:hsa04666 Fc gamma R-mediated phagosome formation
- KEGG:hsa04810 Regulation of actin cytoskeleton
- KEGG:hsa05135 Yersinia infection
- KEGG:hsa05231 Choline metabolism in cancer
Reactome (6)
Mediation Categories (4)
Adhesion and uptake mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence21
Enzyme-Mediated Modification (1)
1 record.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| PIP5K1A | CASP3 | P42574 | D | 279 | cleavage | HPRD | HPRD:11042212 |
Ligand-Receptor Signaling (9)
9 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | Yes | ||||
| intracellular | intracellular | LOCATE | |||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath | |||||
| plasma_membrane | plasma_membrane | UniProt_location | |||||
| plasma_membrane | plasma_membrane | OmniPath | |||||
| receptor | receptor | scConnect | Yes |
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| DVL3 | Q92997 | PI51A | Q99755 | Yes | Yes | SIGNORSignaLink3 | SignaLink3:18772438SignaLink3:23331499SIGNOR:18772438 |
Protein Complex Composition (9)
9 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| mRNA cleavage and polyadenylation specificity factor complex | CPSF1CPSF2CPSF3CPSF4CSNK1A1CSTF2FIP1L1PIP5K1ATUT1 | O95639P33240P48729Q10570Q6UN15Q99755Q9H6E5Q9P2I0Q9UKF6 | 1:1:1:1:1:1:1:1:1 | Compleat | Compleat:HC2438 | 18305108 |
| NRXN3PIP5K1APIP5K1CRABGGTB | O60331P53611Q99755Q9HDB5 | 0:0:0:0 | hu.MAP | |||
| NRXN3PIP5K1APIP5K1CRABGGTB | O60331P53611Q99755Q9Y4C0 | 0:0:0:0 | hu.MAP | |||
| NRXN3PIP5K1APIP5K1CTRIM41 | O60331Q8WV44Q99755Q9HDB5 | 0:0:0:0 | hu.MAP | |||
| NRXN3PIP5K1APIP5K1CTRIM41 | O60331Q8WV44Q99755Q9Y4C0 | 0:0:0:0 | hu.MAP | |||
| PIP5K1APIP5K1C | O60331Q99755 | 0:0 | hu.MAP2 | |||
| NRXN3PIP5K1APIP5K1C | O60331Q99755Q9HDB5 | 0:0:0 | hu.MAP2 | |||
| NRXN3PIP5K1APIP5K1C | O60331Q99755Q9Y4C0 | 0:0:0 | hu.MAP2 | |||
| CSNK1A1PIP5K1A | P48729Q99755 | 0:0 | Havugimana2012 | Havugimana2012:C_80 |
Sequence, Structure & Domains
Sequences
Length
562
Mass
62,633
Sequence
MASASSGPSSSVGFSSFDPAVPSCTLSSAASGIKRPMASEVLEARQDSYISLVPYASGMPIKKIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESIFFPSEGSNLTPAHHYNDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELCSSGASGSLFYVSSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPRSVKMHIKYDLKGSTYKRRASQKEREKPLPTFKDLDFLQDIPDGLFLDADMYNALCKTLQRDCLVLQSFKIMDYSLLMSIHNIDHAQREPLSSETQYSVDTRRPAPQKALYSTAMESIQGEARRGGTMETDDHMGGIPARNSKGERLLLYIGIIDILQSYRFVKKLEHSWKALVHDGDTVSVHRPGFYAERFQRFMCNTVFKKIPLKPSPSKKFRSGSSFSRRAGSSGNSCITYQPSVSGEHKAQVTTKAEVEPGVHLGRPDVLPQTPPLEEISEGSPIPDPSFSPLVGETLQMLTTSTTLEKLEVAESEFTH
Alternative Products
Event=Alternative splicing; Named isoforms=4; Name=1; Synonyms=PIP5KIalpha2; IsoId=Q99755-1; Sequence=Displayed; Name=2; Synonyms=PIP5KIalpha3; IsoId=Q99755-2; Sequence=VSP_016007, VSP_016008; Name=3; Synonyms=PIP5KIalpha1; IsoId=Q99755-3; Sequence=VSP_016007; Name=4; IsoId=Q99755-4; Sequence=VSP_041912, VSP_041913
Alternative Sequence
30..52; ASGIKRPMASEVLEARQDSYISL -> SGIKRPMASE (in isoform 2 and isoform 3); 41..52; Missing (in isoform 4); 382..410; HMGGIPARNSKGERLLLYIGIIDILQSYR -> Q (in isoform 4); 455..504; LKPSPSKKFRSGSSFSRRAGSSGNSCITYQPSVSGEHKAQVTTKAEVEPG -> C (in isoform 2)
Domain & Motif Annotations
Domain (FT)
81..449; PIPK
Region
506..526; Disordered
Clinical Relevance
Disease Involvement
Cancer-related genes
Antibody
Interaction Protein
ENSG00000133703
Interaction Count
1
Interaction Dataset
intact_biogrid
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 40089067 | Metabolic Reprogramming Into a Glycolysis Phenotype Induced by Extracellular Vesicles Derived From Prostate Cancer Cells. | No related sentences available |