Protein detail
COQ7
NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase, mitochondrial (EC 1.14.13.253) (3-demethoxyubiquinone 3-hydroxylase (NADH)) (Timing protein clk-1 homolog) (Ubiquinone biosynthesis monooxygenase COQ7)
Entry name COQ7 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Disease related genesEnzymesHuman disease related genesMetabolic proteinsPotential drug targetsPredicted intracellular proteinsPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase, mitochondrial (EC 1.14.13.253) (3-demethoxyubiquinone 3-hydroxylase (NADH)) (Timing protein clk-1 homolog) (Ubiquinone biosynthesis monooxygenase COQ7)
Protein Class (7)
Disease related genesEnzymesHuman disease related genesMetabolic proteinsPotential drug targetsPredicted intracellular proteinsPredicted membrane proteins
Protein Function (6)
- ENZYME proteins:Oxidoreductases
- Predicted intracellular proteins
- Human disease related genes:Nervous system diseases:Neurodegenerative diseases
- Potential drug targets
- Enzymes
- Disease related genes
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
CAT5CLK-1
Gene Description
Coenzyme Q7, hydroxylase
Chromosome
16
Position
19067614-19080095
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization5
Cell SpecificEndometrial glandular cellsSingle-Nuclei Brain Specificendothelial cellBlood Cell SpecificbasophilBlood Lineage Specificgranulocytes
Function & Pathway7
Protein Function (6)
- ENZYME proteins:Oxidoreductases
- Predicted intracellular proteins
- Human disease related genes:Nervous system diseases:Neurodegenerative diseases
- Potential drug targets
- Enzymes
- Disease related genes
Cellular Component (6)
Molecular Function (5)
- GO:0003682 chromatin binding
- GO:0005515 protein binding
- GO:0008682 3-demethoxyubiquinol 3-hydroxylase activity
- GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
- GO:0046872 metal ion binding
Biological Process (3)
KEGG (3)
Reactome (3)
Mediation Categories (2)
Immune mediationMetabolism mediation
Relations & Evidence10
Ligand-Receptor Signaling (7)
7 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| transmembrane | transmembrane | LOCATE | No | No | No | No | No |
| transmembrane | transmembrane | OmniPath | No | No | No | No | No |
Protein Complex Composition (2)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Polymer Precipitation | Western blotting | 1 | 38731868 |
Sequence, Structure & Domains12
Sequences
Length
217
Mass
24,277
Sequence
MSCAGAAAAPRLWRLRPGARRSLSAYGRRTSVRFRSSGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVAIYLSERL
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q99807-1; Sequence=Displayed; Name=2; IsoId=Q99807-2; Sequence=VSP_039068
Alternative Sequence
1..38; Missing (in isoform 2)
3D Structural Models
Turn
126..128; 157..159; 161..164; 182..185
Helix
46..74; 80..104; 112..125; 131..156; 165..177; 194..214
3D Structure
Electron microscopy (2)
Domain & Motif Annotations
Repeat
48..129; 1; 130..217; 2
Region
11..29; Required for nuclear localization; 48..217; 2 X approximate tandem repeats
Protein Families
COQ7 family
Sequence Similarities
Belongs to the COQ7 family.
Clinical Relevance5
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 38602325 | Transport of CLCA2 to the nucleus by extracellular vesicles controls keratinocyte survival and migration. | Together, these results identify an unexpected nuclear function of CLCA2 in keratinocytes under homeostatic and stress conditions and suggest a role of extracellular vesicles and their nuclear transport in the control of key cellular activities. |