Protein detail

GDIR3

Rho GDP-dissociation inhibitor 3 (Rho GDI 3) (Rho-GDI gamma)

Entry name GDIR3	UniProt ID Q99819	EVMP confidence score 0.38
Supporting publications (n) 1	Transmembrane count	Protein classification

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information6

Protein Names

Rho GDP-dissociation inhibitor 3 (Rho GDI 3) (Rho-GDI gamma)

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000242173

Entrez Gene Symbol

ARHGDIG

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization1

Cell SpecificAlveolar cells type 1

Function & Pathway7

Protein Function

Predicted intracellular proteins

Cellular Component (4)

Molecular Function (3)

Biological Process (3)

KEGG (2)

Reactome (6)

Mediation Categories (2)

Adhesion and uptake mediationReceptor-signaling mediation

Relations & Evidence6

Ligand-Receptor Signaling (4)

4 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Protein Complex Composition (1)

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	ARHGDIG CCDC74B PSMD8	P48556 Q96LY2 Q99819	0:0:0	hu.MAP2

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion ChromatographyMicrofluidics-Based Methods	Mass spectrometry	8	39949490 38225453 40545963 32795414 38731868 33709510 41201090 32089743

Sequence, Structure & Domains5

Sequences

Length

225

Mass

25,098

Sequence

MLGLDACELGAQLLELLRLALCARVLLADKEGGPPAVDEVLDEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPNVQVTRLTLLSEQAPGPVVMDLTGDLAVLKDQVFVLKEGVDYRVKISFKVHREIVSGLKCLHHTYRRGLRVDKTVYMVGSYGPSAQEYEFVTPVEEAPRGALVRGPYLVVSLFTDDDRTHHLSWEWGLCICQDWKD

Domain & Motif Annotations

Protein Families

Rho GDI family

Sequence Similarities

Belongs to the Rho GDI family.

Supporting Publications1

PMID	Title	Abstract
38207106	Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity.	No abstract available