Protein detail

RHG09

Rho GTPase-activating protein 9 (Rho-type GTPase-activating protein 9)

Entry name RHG09	UniProt ID Q9BRR9	EVMP confidence score 0.38
Supporting publications (n) 2	Transmembrane count	Protein classification

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information6

Protein Names

Rho GTPase-activating protein 9 (Rho-type GTPase-activating protein 9)

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000123329

Entrez Gene Symbol

ARHGAP9

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization2

Tissue SpecificliverCell SpecificAdrenal medulla cells

Function & Pathway6

Protein Function

Predicted intracellular proteins

Cellular Component (5)

Molecular Function (3)

Biological Process (3)

Reactome (7)

Mediation Categories (2)

Immune mediationReceptor-signaling mediation

Relations & Evidence7

Ligand-Receptor Signaling (5)

5 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
ecm	ecm	MatrixDB	Yes	No	No	No	No
ecm	ecm	OmniPath	Yes	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Regulatory Interaction Network (1)

1 record.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
RHG09	Q9BRR9	RAC1	P63000	Yes	No	Yes	WangSIGNOR	SIGNOR:32203420

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationDensity Gradient CentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion ChromatographyImmunoaffinity Capture	Mass spectrometryWestern blottingFlow cytometry	9	31508500 34817906 32795414 28986585 30608700 38321535 40098346 41201090 30760538

Sequence, Structure & Domains13

Sequences

Length

750

Mass

83,260

Sequence

MLSSRWWPSSWGILGLGPRSPPRGSQLCALYAFTYTGADGQQVSLAEGDRFLLLRKTNSDWWLARRLEAPSTSRPIFVPAAYMIEESIPSQSPTTVIPGQLLWTPGPKLFHGSLEELSQALPSRAQASSEQPPPLPRKMCRSVSTDNLSPSLLKPFQEGPSGRSLSQEDLPSEASASTAGPQPLMSEPPVYCNLVDLRRCPRSPPPGPACPLLQRLDAWEQHLDPNSGRCFYINSLTGCKSWKPPRRSRSETNPGSMEGTQTLKRNNDVLQPQAKGFRSDTGTPEPLDPQGSLSLSQRTSQLDPPALQAPRPLPQLLDDPHEVEKSGLLNMTKIAQGGRKLRKNWGPSWVVLTGNSLVFYREPPPTAPSSGWGPAGSRPESSVDLRGAALAHGRHLSSRRNVLHIRTIPGHEFLLQSDHETELRAWHRALRTVIERLVRWVEARREAPTGRDQGSGDRENPLELRLSGSGPAELSAGEDEEEESELVSKPLLRLSSRRSSIRGPEGTEQNRVRNKLKRLIAKRPPLQSLQERGLLRDQVFGCQLESLCQREGDTVPSFLRLCIAAVDKRGLDVDGIYRVSGNLAVVQKLRFLVDRERAVTSDGRYVFPEQPGQEGRLDLDSTEWDDIHVVTGALKLFLRELPQPLVPPLLLPHFRAALALSESEQCLSQIQELIGSMPKPNHDTLRYLLEHLCRVIAHSDKNRMTPHNLGIVFGPTLFRPEQETSDPAAHALYPGQLVQLMLTNFTSLFP

Alternative Products

Event=Alternative splicing; Named isoforms=5; Name=1; IsoId=Q9BRR9-1; Sequence=Displayed; Name=2; IsoId=Q9BRR9-2; Sequence=VSP_010325; Name=3; IsoId=Q9BRR9-3; Sequence=VSP_010340; Name=4; IsoId=Q9BRR9-4; Sequence=VSP_010340, VSP_010325; Name=5; IsoId=Q9BRR9-5; Sequence=VSP_010325, VSP_046391

Alternative Sequence

1..184; Missing (in isoform 3 and isoform 4); 438..456; Missing (in isoform 2, isoform 4 and isoform 5); 659..750; ALSESEQCLSQIQELIGSMPKPNHDTLRYLLEHLCRVIAHSDKNRMTPHNLGIVFGPTLFRPEQETSDPAAHALYPGQLVQLMLTNFTSLFP -> G (in isoform 5)

3D Structural Models

Turn

394..396

Helix

368..370; 420..439

Beta Strand

322..336; 346..361; 380..384; 389..392; 398..406; 412..416

3D Structure

X-ray crystallography (3)

Domain & Motif Annotations

Compositional Bias

163..180; Polar residues; 251..270; Polar residues; 291..300; Polar residues; 301..317; Low complexity; 446..462; Basic and acidic residues; 476..485; Acidic residues

Domain (CC)

A region including the PH domain and partially overlapping with the Rho-GAP domain mediates interaction with phosphoinositides.

Domain (FT)

22..88; SH3; 213..247; WW; 322..435; PH; 542..749; Rho-GAP

Region

120..187; Disordered; 242..319; Disordered; 342..345; Lipid binding; 397..399; Lipid binding; 432..669; Lipid binding; 446..488; Disordered

Clinical Relevance3

Interaction Protein

ENSG00000177885

Interaction Count

Interaction Dataset

intact_biogrid

Supporting Publications2

PMID	Title	Abstract
38576002	Therapy-induced senescent tumor cell-derived extracellular vesicles promote colorectal cancer progression through SERPINE1-mediated NF-κB p65 nuclear translocation.	No abstract available
39996590	Surface Double Dendritic Magnetic Microfibrils for Rapid Isolation and Proteomic Profiling of Extracellular Vesicles from Microliters of Biofluids.	No abstract available