Protein detail
MIEN1
Migration and invasion enhancer 1 (HBV X-transactivated gene 4 protein) (HBV XAg-transactivated protein 4) (Protein C35)
Entry name MIEN1 | UniProt ID | EVMP confidence score 0.63 |
Supporting publications (n) 6 | Transmembrane count | Protein classification Predicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Migration and invasion enhancer 1 (HBV X-transactivated gene 4 protein) (HBV XAg-transactivated protein 4) (Protein C35)
Protein Class
Predicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (6)
C17orf37C35MGC14832ORB3Rdx12XTP4
Gene Description
Migration and invasion enhancer 1
Chromosome
17
Position
39728496-39730532
Supporting publications (n)
6
EVMP confidence score
0.63
Fluorescence & Localization1
Function & Pathway5
Protein Function
Predicted intracellular proteins
Cellular Component (4)
Molecular Function
Biological Process (3)
Mediation Categories
Other mediation
Relations & Evidence7
Ligand-Receptor Signaling (6)
6 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry | 1 | 27894104 |
Sequence, Structure & Domains11
Sequences
Length
115
Mass
12,403
Sequence
MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL
3D Structural Models
Turn
31..34; 47..49; 86..90; 97..99
Helix
36..46; 77..80; 91..96
Beta Strand
26..29; 51..53; 56..59; 61..63; 65..68
3D Structure
NMR spectroscopy (1)
Domain & Motif Annotations
Compositional Bias
1..10; Polar residues
Region
1..21; Disordered
Protein Families
SelWTH family
Sequence Similarities
Belongs to the SelWTH family.
Clinical Relevance4
Supporting Publications6
| PMID | Title | Abstract |
|---|---|---|
| 27894104 | Proteomic profiling of NCI-60 extracellular vesicles uncovers common protein cargo and cancer type-specific biomarkers. | No abstract available |
| 28986585 | Quantitation of putative colorectal cancer biomarker candidates in serum extracellular vesicles by targeted proteomics. | No abstract available |
| 31018934 | Proteomic Analysis of Urinary Microvesicles and Exosomes in Medullary Sponge Kidney Disease and Autosomal Dominant Polycystic Kidney Disease. | No abstract available |
| 32284825 | Unravelling the proteomic landscape of extracellular vesicles in prostate cancer by density-based fractionation of urine. | No abstract available |
| 38168906 | Defining the relationship between cellular and extracellular vesicle (EV) content in breast cancer via an integrative multi-omic analysis. | No abstract available |
| 38321535 | Identification of specific markers for human pluripotent stem cell-derived small extracellular vesicles. | No abstract available |