Protein detail

TBCD

Tubulin-specific chaperone D (Beta-tubulin cofactor D) (tfcD) (SSD-1) (Tubulin-folding cofactor D)

Protein symbol TBCD	UniProt ID Q9BTW9	EVMP score 0.38
Frequency	Transmembrane count	Protein classification Disease related genesEssential proteinsHuman disease related genesPredicted intracellular proteinsPredicted membrane proteins

Basic Information

Protein Names

Tubulin-specific chaperone D (Beta-tubulin cofactor D) (tfcD) (SSD-1) (Tubulin-folding cofactor D)

Protein Class

Disease related genesEssential proteinsHuman disease related genesPredicted intracellular proteinsPredicted membrane proteins

Protein Function

Human disease related genes:Nervous system diseases:Neurodegenerative diseases
Disease related genes
Predicted intracellular proteins

Ensembl

ENSG00000141556

Entrez Gene Symbol

TBCD

Gene Description

Tubulin folding cofactor D

Chromosome

Position

82752042-82945914

EVMP Score

0.38

Fluorescence & Localization

Tissue SpecificbrainCell SpecificCone photoreceptor cells

Function & Pathway

Protein Function

Human disease related genes:Nervous system diseases:Neurodegenerative diseases
Disease related genes
Predicted intracellular proteins

Cellular Component

Molecular Function

Biological Process

Reactome

Mediation Categories

Adhesion and uptake mediationFusion and delivery mediationMetabolism mediation

Relations & Evidence

Enzyme-Mediated Modification

0 records.

Ligand-Receptor Signaling

11 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
tight_junction	tight_junction	GO_Intercell	Yes	Yes	No	No	No
tight_junction	tight_junction	OmniPath	Yes	Yes	No	No	No
transmembrane	transmembrane	Ramilowski_location	No	No	No	No	No
transmembrane	transmembrane	OmniPath	No	No	No	No	No
plasma_membrane	plasma_membrane	UniProt_location	No	No	No	No	No
lateral_cell_membrane	plasma_membrane	UniProt_location	No	No	No	No	No

Page 1 of 2Next

Regulatory Interaction Network

0 records.

Protein Complex Composition

5 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
ARL2-TBCD complex	ARL2 TBCD	P36404 Q9BTW9	0:0	CORUM	CORUM:6455	28126905 10831612
	MYL12B MYL6 MYO18A TBCD	O14950 O95411 P60660 Q9BTW9	0:0:0:0	hu.MAP
	MYL12B MYL6 MYL6B TBCD	O14950 P14649 P60660 Q9BTW9	0:0:0:0	hu.MAP
	MYL12B MYL6 MYO18A TBCD	O14950 P60660 Q92614 Q9BTW9	0:0:0:0	hu.MAP
	TARBP1 TBCD	Q13395 Q9BTW9	0:0	hu.MAP

Isolation & Detection Technology

1 record.

EV Isolation Method	Detection Method	Number of References	References
Size Exclusion Chromatography	Mass spectrometry	1	34771645

Sequence, Structure & Domains

Sequences

Length

1,192

Mass

132,600

Sequence

MALSDEPAAGGPEEEAEDETLAFGAALEAFGESAETRALLGRLREVHGGGAEREVALERFRVIMDKYQEQPHLLDPHLEWMMNLLLDIVQDQTSPASLVHLAFKFLYIITKVRGYKTFLRLFPHEVADVEPVLDLVTIQNPKDHEAWETRYMLLLWLSVTCLIPFDFSRLDGNLLTQPGQARMSIMDRILQIAESYLIVSDKARDAAAVLVSRFITRPDVKQSKMAEFLDWSLCNLARSSFQTMQGVITMDGTLQALAQIFKHGKREDCLPYAATVLRCLDGCRLPESNQTLLRKLGVKLVQRLGLTFLKPKVAAWRYQRGCRSLAANLQLLTQGQSEQKPLILTEDDDEDDDVPEGVERVIEQLLVGLKDKDTVVRWSAAKGIGRMAGRLPRALADDVVGSVLDCFSFQETDKAWHGGCLALAELGRRGLLLPSRLVDVVAVILKALTYDEKRGACSVGTNVRDAACYVCWAFARAYEPQELKPFVTAISSALVIAAVFDRDINCRRAASAAFQENVGRQGTFPHGIDILTTADYFAVGNRSNCFLVISVFIAGFPEYTQPMIDHLVTMKISHWDGVIRELAARALHNLAQQAPEFSATQVFPRLLSMTLSPDLHMRHGSILACAEVAYALYKLAAQENRPVTDHLDEQAVQGLKQIHQQLYDRQLYRGLGGQLMRQAVCVLIEKLSLSKMPFRGDTVIDGWQWLINDTLRHLHLISSHSRQQMKDAAVSALAALCSEYYMKEPGEADPAIQEELITQYLAELRNPEEMTRCGFSLALGALPGFLLKGRLQQVLTGLRAVTHTSPEDVSFAESRRDGLKAIARICQTVGVKAGAPDEAVCGENVSQIYCALLGCMDDYTTDSRGDVGTWVRKAAMTSLMDLTLLLARSQPELIEAHTCERIMCCVAQQASEKIDRFRAHAASVFLTLLHFDSPPIPHVPHRGELEKLFPRSDVASVNWSAPSQAFPRITQLLGLPTYRYHVLLGLVVSLGGLTESTIRHSTQSLFEYMKGIQSDPQALGSFSGTLLQIFEDNLLNERVSVPLLKTLDHVLTHGCFDIFTTEEDHPFAVKLLALCKKEIKNSKDIQKLLSGIAVFCEMVQFPGDVRRQALLQLCLLLCHRFPLIRKTTASQVYETLLTYSDVVGADVLDEVVTVLSDTAWDAELAVVREQRNRLCDLLGVPRPQLVPQPGAC

Alternative Products

Event=Alternative splicing; Named isoforms=5; Name=1; IsoId=Q9BTW9-1; Sequence=Displayed; Name=2; IsoId=Q9BTW9-2; Sequence=VSP_017210; Name=3; IsoId=Q9BTW9-3; Sequence=VSP_017211, VSP_017215, VSP_017213, VSP_017214; Name=4; IsoId=Q9BTW9-4; Sequence=VSP_017217, VSP_017218; Name=5; IsoId=Q9BTW9-5; Sequence=VSP_017212, VSP_017216

Alternative Sequence

1..1008; Missing (in isoform 2); 1..546; Missing (in isoform 3); 62..78; Missing (in isoform 5); 547..549; LVI -> MFN (in isoform 3); 662..697; LYDRQLYRGLGGQLMRQAVCVLIEKLSLSKMPFRGD -> PCICSWGLMSPESKAEFCVCVCRISLGRQCVHLSGL (in isoform 3); 698..1192; Missing (in isoform 3); 739..1156; Missing (in isoform 5); 1094; V -> VDFPSATLVCVGTVQMYAHTHLRLGAPGPHCAHGSAMPR (in isoform 4); 1182..1192; RPQLVPQPGAC -> SPTWCPAWCLLKPVLEPIPHPCLVRMSCS (in isoform 4)

3D Structural Models

Domain & Motif Annotations

Repeat

361..399; HEAT 1; 557..594; HEAT 2; 596..632; HEAT 3

Protein Families

TBCD family

Sequence Similarities

Belongs to the TBCD family.

Clinical Relevance

Disease Involvement

Disease variantNeurodegeneration

Antibody

HPA045200

Interaction Protein

ENSG00000213465

Interaction Count

Interaction Dataset

intact_biogrid