Protein detail
ACE2
Angiotensin-converting enzyme 2 (EC 3.4.17.23) (Angiotensin-converting enzyme homolog) (ACEH) (Angiotensin-converting enzyme-related carboxypeptidase) (ACE-related carboxypeptidase) (EC 3.4.17.-) (Metalloprotease MPROT15) [Cleaved into: Processed angiotensin-converting enzyme 2]
Entry name ACE2 | UniProt ID | EVMP confidence score 0.47 |
Supporting publications (n) 0 | Transmembrane count 1 | Protein classification EnzymesMetabolic proteinsPredicted membrane proteinsPredicted secreted proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Angiotensin-converting enzyme 2 (EC 3.4.17.23) (Angiotensin-converting enzyme homolog) (ACEH) (Angiotensin-converting enzyme-related carboxypeptidase) (ACE-related carboxypeptidase) (EC 3.4.17.-) (Metalloprotease MPROT15) [Cleaved into: Processed angiotensin-converting enzyme 2]
Protein Class (5)
EnzymesMetabolic proteinsPredicted membrane proteinsPredicted secreted proteinsTransporters
Protein Function (6)
- Transporters:Electrochemical Potential-driven transporters
- Enzymes
- Predicted secreted proteins
- Transporters:Accessory Factors Involved in Transport
- ENZYME proteins:Hydrolases
- Peptidases:Metallopeptidases
Transmembrane
741..761; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym
ACEH
Gene Description
Angiotensin converting enzyme 2
Chromosome
X
Position
15494566-15607236
Supporting publications (n)
0
EVMP confidence score
0.47
Fluorescence & Localization
Cell SpecificErythrocyte progenitorsSecretome LocationSecreted to bloodSecretome FunctionEnzyme
Function & Pathway
Protein Function (6)
- Transporters:Electrochemical Potential-driven transporters
- Enzymes
- Predicted secreted proteins
- Transporters:Accessory Factors Involved in Transport
- ENZYME proteins:Hydrolases
- Peptidases:Metallopeptidases
Cellular Component (12)
- GO:0005576 extracellular region
- GO:0005615 extracellular space
- GO:0005788 endoplasmic reticulum lumen
- GO:0005886 plasma membrane
- GO:0005929 cilium
- GO:0009986 cell surface
- GO:0016020 membrane
- GO:0016324 apical plasma membrane
- GO:0030666 endocytic vesicle membrane
- GO:0031526 brush border membrane
Page 1 of 2
Molecular Function (8)
Biological Process (3)
KEGG (3)
Reactome (12)
- R-hsa-9694614 attachment and entry
- R-hsa-9772572 early sars cov 2 infection events
- R-hsa-9733458 induction of cell cell fusion
- R-hsa-5663205 infectious disease
- R-hsa-9772573 late sars cov 2 infection events
- R-hsa-2022377 metabolism of angiotensinogen to angiotensins
- R-hsa-2980736 peptide hormone metabolism
- R-hsa-9679191 potential therapeutics for sars
- R-hsa-9678108 sars cov 1 infection
- R-hsa-9694516 sars cov 2 infection
Page 1 of 2
Canonical Pathways
M209 Pid p38 gamma delta pathway
Mediation Categories (6)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence41
Enzyme-Mediated Modification (1)
1 record.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| ACE2 | CSNK2A1 | P68400 | S | 787 | phosphorylation | PhosphoSite |
Ligand-Receptor Signaling (36)
36 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | scConnect | Yes | Yes | Yes | ||
| receptor | receptor | CellCellInteractions | Yes | Yes | Yes | ||
| transmembrane | transmembrane_predicted | Phobius | Yes | Yes | |||
| transmembrane_phobius | transmembrane_predicted | Almen2009 | Yes | Yes | |||
| transmembrane_sosui | transmembrane_predicted | Almen2009 | Yes | Yes | |||
| transmembrane_tmhmm | transmembrane_predicted | Almen2009 | Yes | Yes |
Page 4 of 4Previous
Regulatory Interaction Network (3)
3 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| ACE2 | Q9BYF1 | ANGT | P01019 | Yes | Yes | SIGNORHPRDHINTIntActInnateDB | HPRD:11815627SIGNOR:11815627HINT:10969042IntAct:11815627HPRD:10969042InnateDB:10969042HINT:15283675IntAct:10969042 | |
| ACE2 | Q9BYF1 | APEL | Q9ULZ1 | Yes | Yes | SIGNOR | SIGNOR:11815627 | |
| CSK21 | P68400 | ACE2 | Q9BYF1 | Yes | PhosphoSitePhosphoSite_ProtMapperProtMapper | PhosphoSite:20484496 |
Sequence, Structure & Domains
Sequences
Length
805
Mass
92,463
Sequence
MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQAWDAQRIFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILMCTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNMLRLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGPPNQPPVSIWLIVFGVVMGVIVVGIVILIFTGIRDRKKKNKARSGENPYASIDISKGENNPGFQNTDDVQTSF
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; Synonyms=long; IsoId=Q9BYF1-1; Sequence=Displayed; Name=2; Synonyms=delta, dACE2, short; IsoId=Q9BYF1-3; Sequence=VSP_060903
Alternative Sequence
1..356; MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQAWDAQRIFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDF -> MREAGWDKGG (in isoform 2)
3D Structural Models
Turn
104..107; 144..146; 193..195; 213..215; 253..255; 284..287; 426..428; 559..562; 612..615
Helix
21..52; 56..79; 80..82; 85..87; 91..102; 110..129; 147..154; 158..171; 173..192; 199..204; 205..207; 219..251; 264..266; 276..278; 279..282; 294..299; 304..317; 325..330; 366..384; 385..387; 390..392; 400..412; 415..420; 432..465; 470..472; 473..483; 500..502; 504..507; 514..532; 539..541; 548..558; 566..574; 582..587; 589..598; 599..601; 624..627; 637..657; 667..669; 697..706; 708..715; 741..765
Beta Strand
131..133; 135..139; 141..143; 196..198; 258..260; 267..273; 332..334; 338..340; 347..352; 355..359; 396..399; 422..424; 466..468; 486..488; 494..496; 534..537; 575..578; 607..609; 618..622; 629..631; 670..673; 677..686; 690..694; 719..724
3D Structure
Electron microscopy (245); NMR spectroscopy (1); X-ray crystallography (74)
Domain & Motif Annotations
Compositional Bias
789..805; Polar residues
Motif
778..786; LIR; 781..785; SH2-binding; 781..784; Endocytic sorting signal; 792..795; PTB; 803..805; PDZ-binding
Domain (CC)
The extracellular region of the ACE2 enzyme is composed of two domains. The first is a zinc metallopeptidase domain (residues 19-611). The second domain is located at the C-terminus (residues 612-740) and is 48% identical to human collectrin.; DOMAIN: The cytoplasmic tail contains several linear motifs such as LIR, PDZ-binding, PTB and endocytic sorting signal motifs that would allow interaction with proteins that mediate endocytic trafficking and autophagy.
Domain (FT)
19..607; Peptidase M2; 614..805; Collectrin-like
Region
30..41; Interaction with SARS-CoV spike glycoprotein; 82..84; Interaction with SARS-CoV spike glycoprotein; 353..357; Interaction with SARS-CoV spike glycoprotein; 652..659; Essential for cleavage by ADAM17; 697..716; Essential for cleavage by TMPRSS11D and TMPRSS2; 772..805; Disordered
Protein Families
Peptidase M2 family
Sequence Similarities
Belongs to the peptidase M2 family.
Clinical Relevance
Related Diseases (6)
Biomarker
Phase 1/2; Phase 2; Phase 1; Discontinued in Phase 1; Investigative
Drugs (10)
Interaction Protein (10)
ENSG00000026025ENSG00000044574ENSG00000109062ENSG00000143376ENSG00000150093ENSG00000161681ENSG00000164082ENSG00000174358ENSG00000174827ENSG00000184012
Interaction Count
10
Interaction Dataset
intact_biogrid