Protein detail
OSBL6
Oxysterol-binding protein-related protein 6 (ORP-6) (OSBP-related protein 6)
Entry name OSBL6 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 3 | Transmembrane count | Protein classification Plasma proteinsPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Oxysterol-binding protein-related protein 6 (ORP-6) (OSBP-related protein 6)
Protein Class (2)
Plasma proteinsPredicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
ORP6
Gene Description
Oxysterol binding protein like 6
Chromosome
2
Position
178194481-178402893
Supporting publications (n)
3
EVMP confidence score
0.50
Fluorescence & Localization3
Tissue Specificblood vesselCell SpecificAlveolar cells type 1Single-Nuclei Brain Specificvascular associated smooth muscle cell
Function & Pathway6
Protein Function
Predicted intracellular proteins
Cellular Component (6)
Molecular Function (3)
Reactome (4)
Mediation Categories (2)
Fusion and delivery mediationMetabolism mediation
Relations & Evidence11
Ligand-Receptor Signaling (7)
7 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
Protein Complex Composition (3)
3 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| IMP3IMP4KRI1MPHOSPH10NOP53OSBPL3OSBPL6 | O00566Q8N9T8Q96G21Q9BZF3Q9H4L5Q9NV31Q9NZM5 | 0:0:0:0:0:0:0 | hu.MAP2 | |||
| CDC25COSBPL6PLK1PLK3UBCVRK1VRK3 | P0CG48P30307P53350Q8IV63Q99986Q9BZF3Q9H4B4 | 1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC4528 | ||
| ARRDC1GLMNOSBPL6 | Q8N5I2Q92990Q9BZF3 | 0:0:0 | hu.MAP |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Size Exclusion Chromatography | Mass spectrometry | 1 | 31414377 |
Sequence, Structure & Domains10
Sequences
Length
934
Mass
106,306
Sequence
MSSDEKGISPAHKTSTPTHRSASSSTSSQRDSRQSIHILERTASSSTEPSVSRQLLEPEPVPLSKEADSWEIIEGLKIGQTNVQKPDKHEGFMLKKRKWPLKGWHKRFFVLDNGMLKYSKAPLDIQKGKVHGSIDVGLSVMSIKKKARRIDLDTEEHIYHLKVKSQDWFDAWVSKLRHHRLYRQNEIVRSPRDASFHIFPSTSTAESSPAANVSVMDGKMQPNSFPWQSPLPCSNSLPATCTTGQSKVAAWLQDSEEMDRCAEDLAHCQSNLVELSKLLQNLEILQRTQSAPNFTDMQANCVDISKKDKRVTRRWRTKSVSKDTKIQLQVPFSATMSPVRLHSSNPNLCADIEFQTPPSHLTDPLESSTDYTKLQEEFCLIAQKVHSLLKSAFNSIAIEKEKLKQMVSEQDHSKGHSTQMARLRQSLSQALNQNAELRSRLNRIHSESIICDQVVSVNIIPSPDEAGEQIHVSLPLSQQVANESRLSMSESVSEFFDAQEVLLSASSSENEASDDESYISDVSDNISEDNTSVADNISRQILNGELTGGAFRNGRRACLPAPCPDTSNINLWNILRNNIGKDLSKVSMPVELNEPLNTLQHLCEEMEYSELLDKASETDDPYERMVLVAAFAVSGYCSTYFRAGSKPFNPVLGETYECIREDKGFRFFSEQVSHHPPISACHCESKNFVFWQDIRWKNKFWGKSMEILPVGTLNVMLPKYGDYYVWNKVTTCIHNILSGRRWIEHYGEVTIRNTKSSVCICKLTFVKVNYWNSNMNEVQGVVIDQEGKAVYRLFGKWHEGLYCGVAPSAKCIWRPGSMPTNYELYYGFTRFAIELNELDPVLKDLLPPTDARFRPDQRFLEEGNLEAAASEKQRVEELQRSRRRYMEENNLEHIPKFFKKVIDANQREAWVSNDTYWELRKDPGFSKVDSPVLW
Alternative Products
Event=Alternative splicing; Named isoforms=6; Name=1; IsoId=Q9BZF3-1; Sequence=Displayed; Name=2; IsoId=Q9BZF3-2; Sequence=VSP_010013; Name=3; IsoId=Q9BZF3-3; Sequence=VSP_036559, VSP_036561; Name=4; IsoId=Q9BZF3-4; Sequence=VSP_036560; Name=5; IsoId=Q9BZF3-5; Sequence=VSP_036561; Name=6; IsoId=Q9BZF3-6; Sequence=VSP_036560, VSP_010013, VSP_054430, VSP_054431
Alternative Sequence
1..34; MSSDEKGISPAHKTSTPTHRSASSSTSSQRDSRQ -> MHQLSLIRGNRGR (in isoform 3); 298..328; Missing (in isoform 4 and isoform 6); 329; Q -> QEGPPAKGQFSTTRRRQRLAAAVATT (in isoform 3 and isoform 5); 431..466; Missing (in isoform 2 and isoform 6); 541..575; ILNGELTGGAFRNGRRACLPAPCPDTSNINLWNIL -> SMHHLSFQVVLSTCQIATRRLNEQAFPLPRHPHPC (in isoform 6); 576..934; Missing (in isoform 6)
Domain & Motif Annotations
Compositional Bias
14..29; Low complexity; 30..40; Basic and acidic residues; 42..53; Polar residues
Domain (FT)
86..181; PH
Region
1..62; Disordered
Protein Families
OSBP family
Sequence Similarities
Belongs to the OSBP family.
Clinical Relevance4
Antibody
Interaction Protein (3)
ENSG00000101558ENSG00000108953ENSG00000124164
Interaction Count
3
Interaction Dataset
biogrid_opencell
Supporting Publications3
| PMID | Title | Abstract |
|---|---|---|
| 32854315 | Proteomic Profiling of Extracellular Vesicles Derived from Cerebrospinal Fluid of Alzheimer's Disease Patients: A Pilot Study. | Recent studies have highlighted the importance of Aβ and tau-containing extracellular vesicles (EVs) in AD. |
| 36146834 | Human Cytomegalovirus Modifies Placental Small Extracellular Vesicle Composition to Enhance Infection of Fetal Neural Cells In Vitro. | No abstract available |
| 38207106 | Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity. | No abstract available |