Protein detail

S39A8

Metal cation symporter ZIP8 (BCG-induced integral membrane protein in monocyte clone 103 protein) (LIV-1 subfamily of ZIP zinc transporter 6) (LZT-Hs6) (Solute carrier family 39 member 8) (Zrt- and Irt-like protein 8) (ZIP-8)

Entry name S39A8	UniProt ID Q9C0K1	EVMP confidence score 0.25
Supporting publications (n) 1	Transmembrane count 6	Protein classification Disease related genesHuman disease related genesMetabolic proteinsPotential drug targetsPredicted membrane proteinsTransporters

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Protein Class (6)

Disease related genesHuman disease related genesMetabolic proteinsPotential drug targetsPredicted membrane proteinsTransporters

Protein Function (4)

Transporters:Electrochemical Potential-driven transporters
Disease related genes
Human disease related genes:Congenital disorders of metabolism:Congenital disorders of glycan/glycoprotein metabolism
Potential drug targets

Transmembrane

133..153; Helical; 161..181; Helical; 192..212; Helical; 366..386; Helical; 389..409; Helical; 430..450; Helical

Transmembrane Count

Ensembl

ENSG00000138821

Entrez Gene Symbol

SLC39A8

Gene Synonym

BIGM103

Gene Description

Solute carrier family 39 member 8

Chromosome

Position

102251080-102431258

Supporting publications (n)

EVMP confidence score

0.25

Fluorescence & Localization6

Tissue Specificlymphoid tissueCell SpecificcDCSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell SpecificeosinophilSecretome LocationIntracellular and membraneSecretome FunctionCell adhesion

Function & Pathway7

Protein Function (4)

Transporters:Electrochemical Potential-driven transporters
Disease related genes
Human disease related genes:Congenital disorders of metabolism:Congenital disorders of glycan/glycoprotein metabolism
Potential drug targets

Cellular Component (5)

Molecular Function (3)

Biological Process (3)

KEGG (3)

Reactome (5)

Mediation Categories

Fusion and delivery mediation

Relations & Evidence27

Enzyme-Mediated Modification (1)

1 record.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
SLC39A8	PRKCA	P17252	T	424	phosphorylation	KEA	KEA:17570479

Ligand-Receptor Signaling (23)

23 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
transmembrane	transmembrane	UniProt_topology	No	No	No	No	No
transmembrane	transmembrane	UniProt_keyword	No	No	No	No	No
transmembrane	transmembrane	LOCATE	No	No	No	No	No
transmembrane	transmembrane	Ramilowski_location	No	No	No	No	No
transmembrane	transmembrane	OmniPath	No	No	No	No	No
plasma_membrane	plasma_membrane	UniProt_location	No	No	No	No	No
basolateral_cell_membrane	plasma_membrane	UniProt_location	No	No	No	No	No
apical_cell_membrane	plasma_membrane	UniProt_location	No	No	No	No	No
plasma_membrane	plasma_membrane	OmniPath	No	No	No	No	No
cell_surface	cell_surface	Surfaceome	No	No	No	No	No

Page 2 of 3Previous Next

Protein Complex Composition (2)

2 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	GPD2 SLC39A8 TAOK2	P43304 Q9C0K1 Q9UL54	0:0:0	hu.MAP2
	SLC39A8 TAOK2	Q9C0K1 Q9UL54	0:0	hu.MAP2

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationDensity Gradient CentrifugationSize Exclusion Chromatography	Mass spectrometry	8	34817906 28986585 27894104 39948040 38321535 40089067 33709510 30646616

Sequence, Structure & Domains8

Sequences

Length

460

Mass

49,631

Sequence

MAPGRAVAGLLLLAAAGLGGVAEGPGLAFSEDVLSVFGANLSLSAAQLQHLLEQMGAASRVGVPEPGQLHFNQCLTAEEIFSLHGFSNATQITSSKFSVICPAVLQQLNFHPCEDRPKHKTRPSHSEVWGYGFLSVTIINLASLLGLILTPLIKKSYFPKILTFFVGLAIGTLFSNAIFQLIPEAFGFDPKVDSYVEKAVAVFGGFYLLFFFERMLKMLLKTYGQNGHTHFGNDNFGPQEKTHQPKALPAINGVTCYANPAVTEANGHIHFDNVSVVSLQDGKKEPSSCTCLKGPKLSEIGTIAWMITLCDALHNFIDGLAIGASCTLSLLQGLSTSIAILCEEFPHELGDFVILLNAGMSTRQALLFNFLSACSCYVGLAFGILVGNNFAPNIIFALAGGMFLYISLADMFPEMNDMLREKVTGRKTDFTFFMIQNAGMLTGFTAILLITLYAGEIELE

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q9C0K1-1; Sequence=Displayed; Name=2; IsoId=Q9C0K1-2; Sequence=VSP_029884, VSP_029885; Name=3; IsoId=Q9C0K1-3; Sequence=VSP_043675

Alternative Sequence

1..67; Missing (in isoform 2); 68..72; QLHFN -> MHQHA (in isoform 2); 423..460; VTGRKTDFTFFMIQNAGMLTGFTAILLITLYAGEIELE -> IIKWATDDIKSQLHLLWIYTAR (in isoform 3)

Domain & Motif Annotations

Motif

343..348; XEXPHE-motif

Protein Families

ZIP transporter (TC 2.A.5) family

Sequence Similarities

Belongs to the ZIP transporter (TC 2.A.5) family.

Clinical Relevance3

Disease Involvement

Congenital disorder of glycosylation

Drugs

DEHYDRATED ALCOHOL

Antibody (2)

HPA038832 HPA038833

Supporting Publications1

PMID	Title	Abstract
37941517	Engineered Extracellular Vesicles Expressing Siglec-10 Camouflaged AIE Photosensitizer to Reprogram Macrophages to Active M1 Phenotype and Present Tumor-Associated Antigens for Photodynamic Immunotherapy.	Engineered extracellular vesicles (EVs) that express ICs Siglec-10 are first obtained from 4T1 tumor cells.