Protein detail
S39A8
Metal cation symporter ZIP8 (BCG-induced integral membrane protein in monocyte clone 103 protein) (LIV-1 subfamily of ZIP zinc transporter 6) (LZT-Hs6) (Solute carrier family 39 member 8) (Zrt- and Irt-like protein 8) (ZIP-8)
Entry name S39A8 | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 1 | Transmembrane count 6 | Protein classification Disease related genesHuman disease related genesMetabolic proteinsPotential drug targetsPredicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Metal cation symporter ZIP8 (BCG-induced integral membrane protein in monocyte clone 103 protein) (LIV-1 subfamily of ZIP zinc transporter 6) (LZT-Hs6) (Solute carrier family 39 member 8) (Zrt- and Irt-like protein 8) (ZIP-8)
Protein Class (6)
Disease related genesHuman disease related genesMetabolic proteinsPotential drug targetsPredicted membrane proteinsTransporters
Protein Function (4)
- Transporters:Electrochemical Potential-driven transporters
- Disease related genes
- Human disease related genes:Congenital disorders of metabolism:Congenital disorders of glycan/glycoprotein metabolism
- Potential drug targets
Transmembrane
133..153; Helical; 161..181; Helical; 192..212; Helical; 366..386; Helical; 389..409; Helical; 430..450; Helical
Transmembrane Count
6
Ensembl
Entrez Gene Symbol
Gene Synonym
BIGM103
Gene Description
Solute carrier family 39 member 8
Chromosome
4
Position
102251080-102431258
Supporting publications (n)
1
EVMP confidence score
0.40
Fluorescence & Localization
Tissue Specificlymphoid tissueCell SpecificcDCSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell SpecificeosinophilSecretome LocationIntracellular and membraneSecretome FunctionCell adhesion
Function & Pathway
Protein Function (4)
- Transporters:Electrochemical Potential-driven transporters
- Disease related genes
- Human disease related genes:Congenital disorders of metabolism:Congenital disorders of glycan/glycoprotein metabolism
- Potential drug targets
Cellular Component (5)
Molecular Function (3)
Biological Process (3)
Reactome (5)
Mediation Categories
Fusion and delivery mediation
Relations & Evidence27
Enzyme-Mediated Modification (1)
1 record.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| SLC39A8 | PRKCA | P17252 | T | 424 | phosphorylation | KEA | KEA:17570479 |
Ligand-Receptor Signaling (23)
23 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | UniProt_topology | |||||
| transmembrane | transmembrane | UniProt_keyword | |||||
| transmembrane | transmembrane | LOCATE | |||||
| transmembrane | transmembrane | Ramilowski_location | |||||
| transmembrane | transmembrane | OmniPath | |||||
| plasma_membrane | plasma_membrane | UniProt_location | |||||
| basolateral_cell_membrane | plasma_membrane | UniProt_location | |||||
| apical_cell_membrane | plasma_membrane | UniProt_location | |||||
| plasma_membrane | plasma_membrane | OmniPath | |||||
| cell_surface | cell_surface | Surfaceome |
Protein Complex Composition (2)
Sequence, Structure & Domains
Sequences
Length
460
Mass
49,631
Sequence
MAPGRAVAGLLLLAAAGLGGVAEGPGLAFSEDVLSVFGANLSLSAAQLQHLLEQMGAASRVGVPEPGQLHFNQCLTAEEIFSLHGFSNATQITSSKFSVICPAVLQQLNFHPCEDRPKHKTRPSHSEVWGYGFLSVTIINLASLLGLILTPLIKKSYFPKILTFFVGLAIGTLFSNAIFQLIPEAFGFDPKVDSYVEKAVAVFGGFYLLFFFERMLKMLLKTYGQNGHTHFGNDNFGPQEKTHQPKALPAINGVTCYANPAVTEANGHIHFDNVSVVSLQDGKKEPSSCTCLKGPKLSEIGTIAWMITLCDALHNFIDGLAIGASCTLSLLQGLSTSIAILCEEFPHELGDFVILLNAGMSTRQALLFNFLSACSCYVGLAFGILVGNNFAPNIIFALAGGMFLYISLADMFPEMNDMLREKVTGRKTDFTFFMIQNAGMLTGFTAILLITLYAGEIELE
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q9C0K1-1; Sequence=Displayed; Name=2; IsoId=Q9C0K1-2; Sequence=VSP_029884, VSP_029885; Name=3; IsoId=Q9C0K1-3; Sequence=VSP_043675
Alternative Sequence
1..67; Missing (in isoform 2); 68..72; QLHFN -> MHQHA (in isoform 2); 423..460; VTGRKTDFTFFMIQNAGMLTGFTAILLITLYAGEIELE -> IIKWATDDIKSQLHLLWIYTAR (in isoform 3)
Domain & Motif Annotations
Motif
343..348; XEXPHE-motif
Protein Families
ZIP transporter (TC 2.A.5) family
Sequence Similarities
Belongs to the ZIP transporter (TC 2.A.5) family.
Clinical Relevance
Disease Involvement
Congenital disorder of glycosylation
Related Diseases
Drugs
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 37941517 | Engineered Extracellular Vesicles Expressing Siglec-10 Camouflaged AIE Photosensitizer to Reprogram Macrophages to Active M1 Phenotype and Present Tumor-Associated Antigens for Photodynamic Immunotherapy. | Engineered extracellular vesicles (EVs) that express ICs Siglec-10 are first obtained from 4T1 tumor cells. |