Protein detail
SYT4
Synaptotagmin-4 (Synaptotagmin IV) (SytIV)
Protein symbol SYT4 | UniProt ID | EVMP score 0.50 |
Frequency 5 | Transmembrane count 1 | Protein classification Predicted intracellular proteins |
Basic Information
Protein Names
Synaptotagmin-4 (Synaptotagmin IV) (SytIV)
Protein Class
Predicted intracellular proteins
Protein Function
Predicted intracellular proteins
Transmembrane
17..37; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym
HsT1192KIAA1342
Gene Description
Synaptotagmin 4
Chromosome
18
Position
43267892-43277535
Frequency
5
EVMP Score
0.50
Fluorescence & Localization
Cell SpecificBrain excitatory neuronsBlood Cell SpecificbasophilBlood Lineage Specificgranulocytes
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component
- GO:0000139 Golgi membrane
- GO:0005886 plasma membrane
- GO:0030424 axon
- GO:0030425 dendrite
- GO:0030672 synaptic vesicle membrane
- GO:0032127 dense core granule membrane
- GO:0043025 neuronal cell body
- GO:0045202 synapse
- GO:0048471 perinuclear region of cytoplasm
- GO:0070382 exocytic vesicle
- GO:0097449 astrocyte projection
- GO:0098978 glutamatergic synapse
- GO:0098992 neuronal dense core vesicle
- GO:0099012 neuronal dense core vesicle membrane
- GO:1990742 microvesicle
Molecular Function
Biological Process
Mediation Categories
Fusion and delivery mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
1 record.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| SYT4 | MAPK8 | P45983 | S | 135 | phosphorylation | Sparser_ProtMapperProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:29166604 |
Ligand-Receptor Signaling
16 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | No | No |
| transmembrane_predicted | transmembrane | OmniPath | No | No | No | No | No |
| transmembrane | transmembrane | TopDB | No | No | No | No | No |
| transmembrane | transmembrane | LOCATE | No | No | No | No | No |
Page 1 of 2Next
Regulatory Interaction Network
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| MK08 | P45983 | SYT4 | Q9H2B2 | Yes | Yes | No | Sparser_ProtMapperiPTMnetSIGNORProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:18046461PhosphoSite:18046461ProtMapper:29166604 |
Protein Complex Composition
6 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| CENPAHSP90AA1SYT1SYT3SYT4SYT5 | O00445P07900P21579P49450Q9BQG1Q9H2B2 | 1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC5380 | ||
| CENPAHSP90AA1SV2BSV2CSYT1SYT4 | P07900P21579P49450Q496J9Q7L1I2Q9H2B2 | 1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC4653 | ||
| CENPANUP62SV2BSV2CSYT1SYT4 | P21579P37198P49450Q496J9Q7L1I2Q9H2B2 | 1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC8336 | ||
| CD68CTSOGRNRAPGEF6SYT4 | P28799P34810P43234Q8TEU7Q9H2B2 | 0:0:0:0:0 | hu.MAP2 | |||
| CTSOGRNSYT4 | P28799P43234Q9H2B2 | 0:0:0 | hu.MAP2 | |||
| GRNSYT4 | P28799Q9H2B2 | 0:0 | hu.MAP2 |
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| NA | Mass spectrometry | 0 |
Sequence, Structure & Domains
Sequences
Length
425
Mass
47,958
Sequence
MAPITTSREEFDEIPTVVGIFSAFGLVFTVSLFAWICCQRKSSKSNKTPPYKFVHVLKGVDIYPENLNSKKKFGADDKNEVKNKPAVPKNSLHLDLEKRDLNGNFPKTNLKPGSPSDLENATPKLFLEGEKESVSPESLKSSTSLTSEEKQEKLGTLFFSLEYNFERKAFVVNIKEARGLPAMDEQSMTSDPYIKMTILPEKKHKVKTRVLRKTLDPAFDETFTFYGIPYTQIQELALHFTILSFDRFSRDDIIGEVLIPLSGIELSEGKMLMNREIIKRNVRKSSGRGELLISLCYQSTTNTLTVVVLKARHLPKSDVSGLSDPYVKVNLYHAKKRISKKKTHVKKCTPNAVFNELFVFDIPCEGLEDISVEFLVLDSERGSRNEVIGQLVLGAAAEGTGGEHWKEICDYPRRQIAKWHVLCDG
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9H2B2-1; Sequence=Displayed; Name=2; IsoId=Q9H2B2-2; Sequence=VSP_056643
Alternative Sequence
12..29; Missing (in isoform 2)
3D Structural Models
Turn
185..188; 200..202
Helix
165..167; 233..235
Beta Strand
156..164; 169..179; 191..199; 204..207; 218..226; 237..245; 255..260; 271..276
3D Structure
NMR spectroscopy (1)
Domain & Motif Annotations
Compositional Bias
73..83; Basic and acidic residues; 135..146; Low complexity
Domain (CC)
Unlike in other synaptotagmin family members, the first C2 domain/C2A does not bind Ca(2+) neither mediates Ca(2+)-dependent phospholipid binding. An aspartate-to-serine substitution in this domain inactivates Ca(2+)/phospho-lipid binding.
Domain (FT)
153..274; C2 1; 287..420; C2 2
Region
73..93; Disordered; 127..147; Disordered
Protein Families
Synaptotagmin family
Sequence Similarities
Belongs to the synaptotagmin family.
Clinical Relevance
Antibody