Protein detail
SYT4
Synaptotagmin-4 (Synaptotagmin IV) (SytIV)
Entry name SYT4 | UniProt ID | EVMP confidence score 0.28 |
Supporting publications (n) 5 | Transmembrane count 1 | Protein classification Predicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Synaptotagmin-4 (Synaptotagmin IV) (SytIV)
Protein Class
Predicted intracellular proteins
Protein Function
Predicted intracellular proteins
Transmembrane
17..37; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
HsT1192KIAA1342
Gene Description
Synaptotagmin 4
Chromosome
18
Position
43267892-43277535
Supporting publications (n)
5
EVMP confidence score
0.28
Fluorescence & Localization
Cell SpecificBrain excitatory neuronsBlood Cell SpecificbasophilBlood Lineage Specificgranulocytes
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component (15)
- GO:0000139 Golgi membrane
- GO:0005886 plasma membrane
- GO:0030424 axon
- GO:0030425 dendrite
- GO:0030672 synaptic vesicle membrane
- GO:0032127 dense core granule membrane
- GO:0043025 neuronal cell body
- GO:0045202 synapse
- GO:0048471 perinuclear region of cytoplasm
- GO:0070382 exocytic vesicle
Page 1 of 2
Molecular Function (4)
Biological Process (3)
Mediation Categories (2)
Fusion and delivery mediationReceptor-signaling mediation
Relations & Evidence25
Enzyme-Mediated Modification (1)
1 record.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| SYT4 | MAPK8 | P45983 | S | 135 | phosphorylation | Sparser_ProtMapperProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:29166604 |
Ligand-Receptor Signaling (16)
16 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath | |||||
| transmembrane | transmembrane | UniProt_location | |||||
| transmembrane | transmembrane | UniProt_topology | |||||
| transmembrane | transmembrane | UniProt_keyword | |||||
| transmembrane_predicted | transmembrane | OmniPath | |||||
| transmembrane | transmembrane | TopDB | |||||
| transmembrane | transmembrane | LOCATE |
Page 1 of 2Next
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| MK08 | P45983 | SYT4 | Q9H2B2 | Yes | Yes | Sparser_ProtMapperiPTMnetSIGNORProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:18046461PhosphoSite:18046461ProtMapper:29166604 |
Protein Complex Composition (6)
6 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| CENPAHSP90AA1SYT1SYT3SYT4SYT5 | O00445P07900P21579P49450Q9BQG1Q9H2B2 | 1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC5380 | ||
| CENPAHSP90AA1SV2BSV2CSYT1SYT4 | P07900P21579P49450Q496J9Q7L1I2Q9H2B2 | 1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC4653 | ||
| CENPANUP62SV2BSV2CSYT1SYT4 | P21579P37198P49450Q496J9Q7L1I2Q9H2B2 | 1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC8336 | ||
| CD68CTSOGRNRAPGEF6SYT4 | P28799P34810P43234Q8TEU7Q9H2B2 | 0:0:0:0:0 | hu.MAP2 | |||
| CTSOGRNSYT4 | P28799P43234Q9H2B2 | 0:0:0 | hu.MAP2 | |||
| GRNSYT4 | P28799Q9H2B2 | 0:0 | hu.MAP2 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| NA | Mass spectrometry | 0 |
Sequence, Structure & Domains
Sequences
Length
425
Mass
47,958
Sequence
MAPITTSREEFDEIPTVVGIFSAFGLVFTVSLFAWICCQRKSSKSNKTPPYKFVHVLKGVDIYPENLNSKKKFGADDKNEVKNKPAVPKNSLHLDLEKRDLNGNFPKTNLKPGSPSDLENATPKLFLEGEKESVSPESLKSSTSLTSEEKQEKLGTLFFSLEYNFERKAFVVNIKEARGLPAMDEQSMTSDPYIKMTILPEKKHKVKTRVLRKTLDPAFDETFTFYGIPYTQIQELALHFTILSFDRFSRDDIIGEVLIPLSGIELSEGKMLMNREIIKRNVRKSSGRGELLISLCYQSTTNTLTVVVLKARHLPKSDVSGLSDPYVKVNLYHAKKRISKKKTHVKKCTPNAVFNELFVFDIPCEGLEDISVEFLVLDSERGSRNEVIGQLVLGAAAEGTGGEHWKEICDYPRRQIAKWHVLCDG
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9H2B2-1; Sequence=Displayed; Name=2; IsoId=Q9H2B2-2; Sequence=VSP_056643
Alternative Sequence
12..29; Missing (in isoform 2)
3D Structural Models
Turn
185..188; 200..202
Helix
165..167; 233..235
Beta Strand
156..164; 169..179; 191..199; 204..207; 218..226; 237..245; 255..260; 271..276
3D Structure
NMR spectroscopy (1)
Domain & Motif Annotations
Compositional Bias
73..83; Basic and acidic residues; 135..146; Low complexity
Domain (CC)
Unlike in other synaptotagmin family members, the first C2 domain/C2A does not bind Ca(2+) neither mediates Ca(2+)-dependent phospholipid binding. An aspartate-to-serine substitution in this domain inactivates Ca(2+)/phospho-lipid binding.
Domain (FT)
153..274; C2 1; 287..420; C2 2
Region
73..93; Disordered; 127..147; Disordered
Protein Families
Synaptotagmin family
Sequence Similarities
Belongs to the synaptotagmin family.
Clinical Relevance
Antibody
Supporting Publications5
| PMID | Title | Related sentences |
|---|---|---|
| 30646616 | Preferential Localization of MUC1 Glycoprotein in Exosomes Secreted by Non-Small Cell Lung Carcinoma Cells. | THBS1, ANXA6, HIST1H4A, COL18A1, MDK, SRGN, ENO1, TUBA4A, SLC3A2, GPI, MIF, MUC1, TALDO1, SLC7A5, ICAM1, HSP90AA1, G6PD, and LRP1 were found to be expressed in exosomes at more than 5-fold higher level as compared to total cellular membrane proteins. |
| 32089743 | Human umbilical cord mesenchymal stromal cells-derived extracellular vesicles exert potent bone protective effects by CLEC11A-mediated regulation of bone metabolism. | No related sentences available |
| 32795414 | Extracellular Vesicle and Particle Biomarkers Define Multiple Human Cancers. | Among traditional exosome markers, CD9, HSPA8, ALIX, and HSP90AB1 represent pan-EVP markers, while ACTB, MSN, and RAP1B are novel pan-EVP markers. |
| 33035814 | Knockout of PRDX6 induces mitochondrial dysfunction and cell cycle arrest at G2/M in HepG2 hepatocarcinoma cells. | No related sentences available |
| 38321535 | Identification of specific markers for human pluripotent stem cell-derived small extracellular vesicles. | No related sentences available |