Protein detail

SYT4

Synaptotagmin-4 (Synaptotagmin IV) (SytIV)

Entry name SYT4	UniProt ID Q9H2B2	EVMP confidence score 0.50
Supporting publications (n) 5	Transmembrane count 1	Protein classification Predicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Synaptotagmin-4 (Synaptotagmin IV) (SytIV)

Protein Class

Predicted intracellular proteins

Protein Function

Predicted intracellular proteins

Transmembrane

17..37; Helical

Transmembrane Count

Ensembl

ENSG00000132872

Entrez Gene Symbol

SYT4

Gene Synonym (2)

HsT1192KIAA1342

Gene Description

Synaptotagmin 4

Chromosome

Position

43267892-43277535

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization4

Cell SpecificBrain excitatory neuronsBlood Cell SpecificbasophilBlood Lineage Specificgranulocytes

Function & Pathway5

Protein Function

Predicted intracellular proteins

Cellular Component (15)

Page 1 of 2

Molecular Function (4)

Biological Process (3)

Mediation Categories (2)

Fusion and delivery mediationReceptor-signaling mediation

Relations & Evidence25

Enzyme-Mediated Modification (1)

1 record.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
SYT4	MAPK8	P45983	S	135	phosphorylation	Sparser_ProtMapperProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:29166604

Ligand-Receptor Signaling (16)

16 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
transmembrane	transmembrane	UniProt_location	No	No	No	No	No
transmembrane	transmembrane	UniProt_topology	No	No	No	No	No
transmembrane	transmembrane	UniProt_keyword	No	No	No	No	No
transmembrane_predicted	transmembrane	OmniPath	No	No	No	No	No
transmembrane	transmembrane	TopDB	No	No	No	No	No
transmembrane	transmembrane	LOCATE	No	No	No	No	No

Page 1 of 2Next

Regulatory Interaction Network (1)

1 record.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
MK08	P45983	SYT4	Q9H2B2	Yes	Yes	No	Sparser_ProtMapperiPTMnetSIGNORProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper	SIGNOR:18046461 PhosphoSite:18046461 ProtMapper:29166604

Protein Complex Composition (6)

6 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
CENPA HSP90AA1 SYT1 SYT3 SYT4 SYT5	O00445 P07900 P21579 P49450 Q9BQG1 Q9H2B2	1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5380
CENPA HSP90AA1 SV2B SV2C SYT1 SYT4	P07900 P21579 P49450 Q496J9 Q7L1I2 Q9H2B2	1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC4653
CENPA NUP62 SV2B SV2C SYT1 SYT4	P21579 P37198 P49450 Q496J9 Q7L1I2 Q9H2B2	1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC8336
CD68 CTSO GRN RAPGEF6 SYT4	P28799 P34810 P43234 Q8TEU7 Q9H2B2	0:0:0:0:0	hu.MAP2
CTSO GRN SYT4	P28799 P43234 Q9H2B2	0:0:0	hu.MAP2
GRN SYT4	P28799 Q9H2B2	0:0	hu.MAP2

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
NA	Mass spectrometry	0

Sequence, Structure & Domains15

Sequences

Length

425

Mass

47,958

Sequence

MAPITTSREEFDEIPTVVGIFSAFGLVFTVSLFAWICCQRKSSKSNKTPPYKFVHVLKGVDIYPENLNSKKKFGADDKNEVKNKPAVPKNSLHLDLEKRDLNGNFPKTNLKPGSPSDLENATPKLFLEGEKESVSPESLKSSTSLTSEEKQEKLGTLFFSLEYNFERKAFVVNIKEARGLPAMDEQSMTSDPYIKMTILPEKKHKVKTRVLRKTLDPAFDETFTFYGIPYTQIQELALHFTILSFDRFSRDDIIGEVLIPLSGIELSEGKMLMNREIIKRNVRKSSGRGELLISLCYQSTTNTLTVVVLKARHLPKSDVSGLSDPYVKVNLYHAKKRISKKKTHVKKCTPNAVFNELFVFDIPCEGLEDISVEFLVLDSERGSRNEVIGQLVLGAAAEGTGGEHWKEICDYPRRQIAKWHVLCDG

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9H2B2-1; Sequence=Displayed; Name=2; IsoId=Q9H2B2-2; Sequence=VSP_056643

Alternative Sequence

12..29; Missing (in isoform 2)

3D Structural Models

Turn

185..188; 200..202

Helix

165..167; 233..235

Beta Strand

156..164; 169..179; 191..199; 204..207; 218..226; 237..245; 255..260; 271..276

3D Structure

NMR spectroscopy (1)

Domain & Motif Annotations

Compositional Bias

73..83; Basic and acidic residues; 135..146; Low complexity

Domain (CC)

Unlike in other synaptotagmin family members, the first C2 domain/C2A does not bind Ca(2+) neither mediates Ca(2+)-dependent phospholipid binding. An aspartate-to-serine substitution in this domain inactivates Ca(2+)/phospho-lipid binding.

Domain (FT)

153..274; C2 1; 287..420; C2 2

Region

73..93; Disordered; 127..147; Disordered

Protein Families

Synaptotagmin family

Sequence Similarities

Belongs to the synaptotagmin family.

Clinical Relevance1

Antibody

HPA010574

Supporting Publications5

PMID	Title	Abstract
30646616	Preferential Localization of MUC1 Glycoprotein in Exosomes Secreted by Non-Small Cell Lung Carcinoma Cells.	THBS1, ANXA6, HIST1H4A, COL18A1, MDK, SRGN, ENO1, TUBA4A, SLC3A2, GPI, MIF, MUC1, TALDO1, SLC7A5, ICAM1, HSP90AA1, G6PD, and LRP1 were found to be expressed in exosomes at more than 5-fold higher level as compared to total cellular membrane proteins.
32089743	Human umbilical cord mesenchymal stromal cells-derived extracellular vesicles exert potent bone protective effects by CLEC11A-mediated regulation of bone metabolism.	No abstract available
32795414	Extracellular Vesicle and Particle Biomarkers Define Multiple Human Cancers.	Among traditional exosome markers, CD9, HSPA8, ALIX, and HSP90AB1 represent pan-EVP markers, while ACTB, MSN, and RAP1B are novel pan-EVP markers.
33035814	Knockout of PRDX6 induces mitochondrial dysfunction and cell cycle arrest at G2/M in HepG2 hepatocarcinoma cells.	No abstract available
38321535	Identification of specific markers for human pluripotent stem cell-derived small extracellular vesicles.	No abstract available