Protein detail

TTYH1

Protein tweety homolog 1 (hTTY1) (Volume-regulated anion channel subunit TTYH1)

Entry name TTYH1	UniProt ID Q9H313	EVMP confidence score 0.50
Supporting publications (n) 1	Transmembrane count 5	Protein classification Predicted membrane proteinsTransporters

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information12

Protein Names

Protein tweety homolog 1 (hTTY1) (Volume-regulated anion channel subunit TTYH1)

Protein Class (2)

Predicted membrane proteinsTransporters

Protein Function

Transporters:Transporter channels and pores

Transmembrane

44..64; Helical; Name=1; 89..109; Helical; Name=2; 215..235; Helical; Name=3; 241..261; Helical; Name=4; 391..411; Helical; Name=5

Transmembrane Count

Ensembl

ENSG00000167614

Entrez Gene Symbol

TTYH1

Gene Description

Tweety family member 1

Chromosome

Position

54415219-54436904

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization2

Cell SpecificCorticotrophs

Function & Pathway6

Protein Function

Transporters:Transporter channels and pores

Cellular Component (7)

Molecular Function (6)

Biological Process (3)

Reactome (3)

Mediation Categories (2)

Adhesion and uptake mediationFusion and delivery mediation

Relations & Evidence31

Ligand-Receptor Signaling (29)

29 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
transmembrane	transmembrane	TopDB	No	No	No	No	No
transmembrane	transmembrane	Ramilowski_location	No	No	No	No	No
transmembrane	transmembrane	OmniPath	No	No	No	No	No
plasma_membrane	plasma_membrane	UniProt_location	No	No	No	No	No
plasma_membrane	plasma_membrane	Cellinker	No	No	No	No	No
plasma_membrane	plasma_membrane	OmniPath	No	No	No	No	No
cell_surface	cell_surface	Surfaceome	No	No	No	No	No
cell_surface	cell_surface	OmniPath	No	No	No	No	No
transmembrane	transmembrane_predicted	Phobius	No	No	No	No	No

Page 3 of 3Previous

Protein Complex Composition (1)

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	TTYH1	Q9H313	2	PDB	PDB:7p5j

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential Ultracentrifugation	Western blotting	1	39996590

Sequence, Structure & Domains9

Sequences

Length

450

Mass

49,051

Sequence

MGAPPGYRPSAWVHLLHQLPRADFQLRPVPSVFAPQEQEYQQALLLVAALAGLGLGLSLIFIAVYLIRFCCCRPPEPPGSKIPSPGGGCVTWSCIVALLAGCTGIGIGFYGNSETSDGVSQLSSALLHANHTLSTIDHLVLETVERLGEAVRTELTTLEEVLEPRTELVAAARGARRQAEAAAQQLQGLAFWQGVPLSPLQVAENVSFVEEYRWLAYVLLLLLELLVCLFTLLGLAKQSKWLVIVMTVMSLLVLVLSWGSMGLEAATAVGLSDFCSNPDPYVLNLTQEETGLSSDILSYYLLCNRAVSNPFQQRLTLSQRALANIHSQLLGLEREAVPQFPSAQKPLLSLEETLNVTEGNFHQLVALLHCRSLHKDYGAALRGLCEDALEGLLFLLLFSLLSAGALATALCSLPRAWALFPPSDDYDDTDDDDPFNPQESKRFVQWQSSI

Alternative Products

Event=Alternative splicing; Named isoforms=5; Name=1; IsoId=Q9H313-1; Sequence=Displayed; Name=2; IsoId=Q9H313-2; Sequence=VSP_029760; Name=3; Synonyms=TTYH1s; IsoId=Q9H313-3; Sequence=VSP_029759; Name=4; IsoId=Q9H313-4; Sequence=VSP_029753, VSP_029757, VSP_029760; Name=5; IsoId=Q9H313-5; Sequence=VSP_029754, VSP_029755, VSP_029756, VSP_029758

Alternative Sequence

1..212; Missing (in isoform 4); 1..85; Missing (in isoform 5); 86..101; GGGCVTWSCIVALLAG -> MEKVRLWRGSESRAAI (in isoform 5); 140..142; Missing (in isoform 5); 213; R -> M (in isoform 4); 376..450; DYGAALRGLCEDALEGLLFLLLFSLLSAGALATALCSLPRAWALFPPSDDYDDTDDDDPFNPQESKRFVQWQSSI -> VKPLPSQFLLPRGASVSTHRTTSSFSLDPCHCA (in isoform 5); 423..450; SDDYDDTDDDDPFNPQESKRFVQWQSSI -> RNPSALCSGSRLSEPLLPAGLEPGSPLRSFPGCRRRPH (in isoform 3); 437; P -> PQ (in isoform 2 and isoform 4)

3D Structural Models

3D Structure

Electron microscopy (1)

Domain & Motif Annotations

Region

428..450; Disordered

Protein Families

Tweety family

Sequence Similarities

Belongs to the tweety family.

Clinical Relevance4

Antibody (3)

HPA005725 HPA023617 HPA050655

Interaction Protein

ENSG00000170775

Interaction Count

Interaction Dataset

intact_biogrid

Supporting Publications1

PMID	Title	Abstract
38795909	Proteomic profile of tissue-derived extracellular vesicles from benign odontogenic lesions.	No abstract available