Protein detail
TXNIP
Thioredoxin-interacting protein (Thioredoxin-binding protein 2) (Vitamin D3 up-regulated protein 1)
Entry name TXNIP | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 2 | Transmembrane count | Protein classification Cancer-related genesPredicted intracellular proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Thioredoxin-interacting protein (Thioredoxin-binding protein 2) (Vitamin D3 up-regulated protein 1)
Protein Class (3)
Cancer-related genesPredicted intracellular proteinsTransporters
Protein Function (3)
- Cancer-related genes:Mutational cancer driver genes
- Predicted intracellular proteins
- Transporters:Accessory Factors Involved in Transport
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
ARRDC6EST01027HHCPA78THIFVDUP1
Gene Description
Thioredoxin interacting protein
Chromosome
1
Position
145992435-145996579
Supporting publications (n)
2
EVMP confidence score
0.38
Fluorescence & Localization1
Function & Pathway7
Protein Function (3)
- Cancer-related genes:Mutational cancer driver genes
- Predicted intracellular proteins
- Transporters:Accessory Factors Involved in Transport
Cellular Component (2)
Molecular Function (3)
Biological Process (3)
Reactome (13)
- R-hsa-8953897 cellular responses to stimuli
- R-hsa-9711123 cellular response to chemical stress
- R-hsa-9707564 cytoprotection by hmox1
- R-hsa-9614085 foxo mediated transcription
- R-hsa-5663205 infectious disease
- R-hsa-622312 inflammasomes
- R-hsa-168249 innate immune system
- R-hsa-9658195 leishmania infection
- R-hsa-168643 nucleotide binding domain leucine rich repeat containing receptor nlr signaling pathways
- R-hsa-9660826 purinergic signaling in leishmaniasis infection
Page 1 of 2
Mediation Categories (2)
Clinical-translation mediationImmune mediation
Relations & Evidence18
Enzyme-Mediated Modification (3)
Ligand-Receptor Signaling (5)
5 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Regulatory Interaction Network (4)
4 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| MK01 | P28482 | TXNIP | Q9H3M7 | Yes | No | Yes | SIGNORPhosphoSitePhosphoSite_ProtMapperProtMapper | PhosphoSite:30410860SIGNOR:31320475PhosphoSite:31320475 |
| COMPLEX:O43741_P54619_P54646_Q13131_Q9UGI9_Q9UGJ0_Q9Y478 | TXNIP | Q9H3M7 | Yes | No | Yes | SIGNOR | SIGNOR:23453806 | |
| TXNIP | Q9H3M7 | DDIT4 | Q9NX09 | Yes | Yes | No | SIGNOR | SIGNOR:21460850 |
| AAPK1 | Q13131 | TXNIP | Q9H3M7 | Yes | No | No | PhosphoSitePhosphoSite_ProtMapperProtMapper | PhosphoSite:23453806 |
Protein Complex Composition (5)
5 records.
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 30805606 |
Sequence, Structure & Domains10
Sequences
Length
391
Mass
43,661
Sequence
MVMFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTSEYLRYEDTLLLEDQPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAFLDRPSQPTQETKKNFEVVDLVDVNTPDLMAPVSAKKEKKVSCMFIPDGRVSVSARIDRKGFCEGDEISIHADFENTCSRIVVPKAAIVARHTYLANGQTKVLTQKLSSVRGNHIISGTCASWRGKSLRVQKIRPSILGCNILRVEYSLLIYVSVPGSKKVILDLPLVIGSRSGLSSRTSSMASRTSSEMSWVDLNIPDTPEAPPCYMDVIPEDHRLESPTTPLLDDMDGSQDSPIFMYAPEFKFMPPPTYTEVDPCILNNNVQ
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9H3M7-1; Sequence=Displayed; Name=2; IsoId=Q9H3M7-2; Sequence=VSP_054401
Alternative Sequence
1..83; MVMFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTSEYLRYEDTLLLEDQPT -> MPPKHSLSHRCILSVTASLMATRFSFPS (in isoform 2)
3D Structural Models
Helix
334..337
Beta Strand
8..16; 20..22; 26..34; 39..41; 43..58; 61..76; 79..81; 83..85; 89..91; 93..95; 97..104; 111..114; 116..130; 137..142; 144..146; 148..150; 160..167; 177..185; 187..190; 194..203; 205..207; 209..223; 226..238; 246..256; 269..281; 288..298
3D Structure
X-ray crystallography (11)
Domain & Motif Annotations
Protein Families
Arrestin family
Sequence Similarities
Belongs to the arrestin family.
Clinical Relevance6
Disease Involvement (2)
Cancer-related genesTumor suppressor
Interaction Protein (3)
ENSG00000122882ENSG00000136810ENSG00000196591
Interaction Count
3
Interaction Dataset
intact_biogrid
Supporting Publications2
| PMID | Title | Abstract |
|---|---|---|
| 36347401 | Exosome proteomics study of the effects of traditional cigarettes and electronic cigarettes on human bronchial epithelial cells. | In this study, we evaluated the cytotoxicities of e-Cig and t-Cig condensate solutions (e-CigCS and t-CigCS) on human bronchial epithelial cells (16HBE cells) in vitro, and employed the exosome proteomic technique to systematically assess the effects of e-CigCS and t-CigCS on 16HBE cells. |
| 37154070 | CIRC_0001818 TARGETS MIR-136-5P TO INCREASE LIPOPOLYSACCHARIDE-INDUCED HK2 CELL INJURIES BY ACTIVATING TXNIP/NLRP3 INFLAMMASOME PATHWAY. | The receiver operating characteristic curve was depicted to assess the diagnostic value of circ_0001818, miR-136-5p, and TXNIP in serumal exosomes from patients with septic AKI. |