Protein detail
TMPS5
Transmembrane protease serine 5 (EC 3.4.21.-) (Spinesin)
Entry name TMPS5 | UniProt ID | EVMP confidence score 0.25 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information8
Protein Names
Transmembrane protease serine 5 (EC 3.4.21.-) (Spinesin)
Protein Function (5)
- Predicted intracellular proteins
- Potential drug targets
- Peptidases:Serine-type peptidases
- Enzymes
- Disease related genes
Transmembrane
50..70; Helical; Signal-anchor for type II membrane protein
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Supporting publications (n)
1
EVMP confidence score
0.25
Fluorescence & Localization1
Cell SpecificAstrocytes
Function & Pathway5
Protein Function (5)
- Predicted intracellular proteins
- Potential drug targets
- Peptidases:Serine-type peptidases
- Enzymes
- Disease related genes
Cellular Component (2)
Molecular Function (2)
Biological Process (3)
Mediation Categories
Other mediation
Relations & Evidence26
Ligand-Receptor Signaling (25)
25 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | No | Yes | No | Yes | No |
| intracellular | intracellular | ComPPI | No | No | No | Yes | No |
| intracellular | intracellular | OmniPath | No | No | No | Yes | No |
| cell_surface_enzyme | cell_surface_enzyme | Surfaceome | Yes | No | No | Yes | No |
| scavenger_receptor_cysteine_rich | cell_surface_enzyme | OmniPath | Yes | No | No | Yes | No |
| serine_protease | cell_surface_peptidase | OmniPath | Yes | No | No | Yes | No |
| cell_surface_enzyme | cell_surface_enzyme | OmniPath | Yes | No | No | Yes | No |
| cell_surface_peptidase | cell_surface_peptidase | OmniPath | Yes | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | Yes | No |
Page 1 of 3Next
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Western blotting | 1 | 39996590 |
Sequence, Structure & Domains7
Sequences
Length
457
Mass
49,560
Sequence
MSLMLDDQPPMEAQYAEEGPGPGIFRAEPGDQQHPISQAVCWRSMRRGCAVLGALGLLAGAGVGSWLLVLYLCPAASQPISGTLQDEEITLSCSEASAEEALLPALPKTVSFRINSEDFLLEAQVRDQPRWLLVCHEGWSPALGLQICWSLGHLRLTHHKGVNLTDIKLNSSQEFAQLSPRLGGFLEEAWQPRNNCTSGQVVSLRCSECGARPLASRIVGGQSVAPGRWPWQASVALGFRHTCGGSVLAPRWVVTAAHCMHSFRLARLSSWRVHAGLVSHSAVRPHQGALVERIIPHPLYSAQNHDYDVALLRLQTALNFSDTVGAVCLPAKEQHFPKGSRCWVSGWGHTHPSHTYSSDMLQDTVVPLFSTQLCNSSCVYSGALTPRMLCAGYLDGRADACQGDSGGPLVCPDGDTWRLVGVVSWGRGCAEPNHPGVYAKVAEFLDWIHDTAQDSLL
Domain & Motif Annotations
Domain (FT)
112..207; SRCR; 218..453; Peptidase S1
Region
1..21; Disordered
Protein Families
Peptidase S1 family
Sequence Similarities
Belongs to the peptidase S1 family.
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 38731868 | The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer. | No abstract available |