Protein detail

JUPI2

Jupiter microtubule associated homolog 2 (Hematological and neurological expressed 1-like protein) (HN1-like protein)

Entry name JUPI2	UniProt ID Q9H910	EVMP confidence score 0.38
Supporting publications (n) 2	Transmembrane count	Protein classification Predicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Jupiter microtubule associated homolog 2 (Hematological and neurological expressed 1-like protein) (HN1-like protein)

Protein Class

Predicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000206053

Entrez Gene Symbol

JPT2

Gene Synonym (5)

C16orf34FLJ13092HN1LKIAA1426L11

Gene Description

Jupiter microtubule associated homolog 2

Chromosome

Position

1678256-1702280

Supporting publications (n)

EVMP confidence score

0.38

Function & Pathway6

Protein Function

Predicted intracellular proteins

Cellular Component (4)

Molecular Function

GO:0005515 protein binding

Biological Process (3)

Canonical Pathways

M255 Pid hif1 tfpathway

Mediation Categories

Receptor-signaling mediation

Relations & Evidence10

Enzyme-Mediated Modification (1)

1 record.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
JPT2	CDK2	P24941	S	97	phosphorylation	phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPProtMapperPhosphoSitePhosphoSite_ProtMapper

Ligand-Receptor Signaling (5)

5 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Protein Complex Composition (3)

3 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database
DMC1 FIGNL1 JPT2 RAD51	Q06609 Q14565 Q6PIW4 Q9H910	0:0:0:0	hu.MAP2
JPT2 UBAP2	Q5T6F2 Q9H910	0:0	hu.MAP
CES3 FIGNL1 JPT2 LMLN TMEM25	Q6PIW4 Q6UWW8 Q86YD3 Q96KR4 Q9H910	0:0:0:0:0	hu.MAP2

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Antibody arrayMass spectrometry	1	36146834

Sequence, Structure & Domains9

Sequences

Length

190

Mass

20,063

Sequence

MFQVPDSEGGRAGSRAMKPPGGESSNLFGSPEEATPSSRPNRMASNIFGPTEEPQNIPKRTNPPGGKGSGIFDESTPVQTRQHLNPPGGKTSDIFGSPVTATSRLAHPNKPKDHVFLCEGEEPKSDLKAARSIPAGAEPGEKGSARKAGPAKEQEPMPTVDSHEPRLGPRPRSHNKVLNPPGGKSSISFY

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; Synonyms=HN1LA; IsoId=Q9H910-1; Sequence=Displayed; Name=2; Synonyms=HN1LB, HN1LC; IsoId=Q9H910-2; Sequence=VSP_014706; Name=3; IsoId=Q9H910-3; Sequence=VSP_057423

Alternative Sequence

1..17; MFQVPDSEGGRAGSRAM -> M (in isoform 2); 14; S -> SRKWQLLTGSLASTSPSLLSGQGPWAPLQ (in isoform 3)

Domain & Motif Annotations

Compositional Bias

35..44; Polar residues; 110..129; Basic and acidic residues; 139..167; Basic and acidic residues

Region

1..190; Disordered

Protein Families

JUPITER family

Sequence Similarities

Belongs to the JUPITER family.

Clinical Relevance1

Antibody (2)

HPA041888 HPA041908

Supporting Publications2

PMID	Title	Abstract
37922300	Proteomic profiling of urinary extracellular vesicles differentiates breast cancer patients from healthy women.	No abstract available
38731868	The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer.	No abstract available