Protein detail
JUPI2
Jupiter microtubule associated homolog 2 (Hematological and neurological expressed 1-like protein) (HN1-like protein)
Entry name JUPI2 | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 2 | Transmembrane count | Protein classification Predicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Jupiter microtubule associated homolog 2 (Hematological and neurological expressed 1-like protein) (HN1-like protein)
Protein Class
Predicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
C16orf34FLJ13092HN1LKIAA1426L11
Gene Description
Jupiter microtubule associated homolog 2
Chromosome
16
Position
1678256-1702280
Supporting publications (n)
2
EVMP confidence score
0.38
Function & Pathway6
Protein Function
Predicted intracellular proteins
Cellular Component (4)
Molecular Function
Biological Process (3)
Canonical Pathways
M255 Pid hif1 tfpathway
Mediation Categories
Receptor-signaling mediation
Relations & Evidence10
Enzyme-Mediated Modification (1)
1 record.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| JPT2 | CDK2 | P24941 | S | 97 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPProtMapperPhosphoSitePhosphoSite_ProtMapper |
Ligand-Receptor Signaling (5)
5 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Protein Complex Composition (3)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Antibody arrayMass spectrometry | 1 | 36146834 |
Sequence, Structure & Domains9
Sequences
Length
190
Mass
20,063
Sequence
MFQVPDSEGGRAGSRAMKPPGGESSNLFGSPEEATPSSRPNRMASNIFGPTEEPQNIPKRTNPPGGKGSGIFDESTPVQTRQHLNPPGGKTSDIFGSPVTATSRLAHPNKPKDHVFLCEGEEPKSDLKAARSIPAGAEPGEKGSARKAGPAKEQEPMPTVDSHEPRLGPRPRSHNKVLNPPGGKSSISFY
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; Synonyms=HN1LA; IsoId=Q9H910-1; Sequence=Displayed; Name=2; Synonyms=HN1LB, HN1LC; IsoId=Q9H910-2; Sequence=VSP_014706; Name=3; IsoId=Q9H910-3; Sequence=VSP_057423
Alternative Sequence
1..17; MFQVPDSEGGRAGSRAM -> M (in isoform 2); 14; S -> SRKWQLLTGSLASTSPSLLSGQGPWAPLQ (in isoform 3)
Domain & Motif Annotations
Compositional Bias
35..44; Polar residues; 110..129; Basic and acidic residues; 139..167; Basic and acidic residues
Region
1..190; Disordered
Protein Families
JUPITER family
Sequence Similarities
Belongs to the JUPITER family.
Supporting Publications2
| PMID | Title | Abstract |
|---|---|---|
| 37922300 | Proteomic profiling of urinary extracellular vesicles differentiates breast cancer patients from healthy women. | No abstract available |
| 38731868 | The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer. | No abstract available |