Protein detail
GBB4
Guanine nucleotide-binding protein subunit beta-4 (Transducin beta chain 4)
Entry name GBB4 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Disease related genesHuman disease related genesPredicted intracellular proteinsRAS pathway related proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Guanine nucleotide-binding protein subunit beta-4 (Transducin beta chain 4)
Protein Class (4)
Disease related genesHuman disease related genesPredicted intracellular proteinsRAS pathway related proteins
Protein Function (4)
- Human disease related genes:Nervous system diseases:Neurodegenerative diseases
- Disease related genes
- Predicted intracellular proteins
- RAS pathway related proteins
Ensembl
Entrez Gene Symbol
Gene Description
G protein subunit beta 4
Chromosome
3
Position
179396088-179451476
Supporting publications (n)
1
EVMP confidence score
0.53
Fluorescence & Localization
Tissue Specificadipose tissueBrain Regional Specificchoroid plexusCell SpecificHepatocytesSingle-Nuclei Brain Specificfibroblast
Function & Pathway
Protein Function (4)
- Human disease related genes:Nervous system diseases:Neurodegenerative diseases
- Disease related genes
- Predicted intracellular proteins
- RAS pathway related proteins
Cellular Component (7)
Molecular Function (3)
Biological Process (3)
KEGG (20)
- hsa04014 Ras signaling pathway
- KEGG:hsa04062 Chemokine signaling pathway
- KEGG:hsa04081 Hormone signaling
- KEGG:hsa04082 Neuroactive ligand signaling
- KEGG:hsa04151 PI3K-Akt signaling pathway
- KEGG:hsa04371 Apelin signaling pathway
- KEGG:hsa04713 Circadian entrainment
- KEGG:hsa04723 Retrograde endocannabinoid signaling
- KEGG:hsa04724 Glutamatergic synapse
- KEGG:hsa04725 Cholinergic synapse
Page 1 of 2
Reactome (56)
- R-hsa-451326 activation of kainate receptors upon glutamate binding
- R-hsa-9660821 adora2b mediated anti inflammatory cytokines production
- R-hsa-418592 adp signalling through p2y purinoceptor 1
- R-hsa-392170 adp signalling through p2y purinoceptor 12
- R-hsa-400042 adrenaline noradrenaline inhibits insulin secretion
- R-hsa-9662851 anti inflammatory response favouring leishmania parasite infection
- R-hsa-445717 aquaporin mediated transport
- R-hsa-3858494 beta catenin independent wnt signaling
- R-hsa-4086398 ca2 pathway
- R-hsa-9855142 cellular responses to mechanical stimuli
Page 1 of 6
Mediation Categories (3)
Fusion and delivery mediationImmune mediationMetabolism mediation
Relations & Evidence10
Ligand-Receptor Signaling (4)
4 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | |||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | OmniPath |
Protein Complex Composition (5)
5 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| GNAI1-GNB4-GNG12 complex | GNAI1GNB4GNG12 | P63096Q9HAV0Q9UBI6 | 0:0:0 | CORUM | CORUM:7089 | 25733868 |
| GNAI1-GNB4-GNG13 complex | GNAI1GNB4GNG13 | P63096Q9HAV0Q9P2W3 | 0:0:0 | CORUM | CORUM:7095 | 25733868 |
| GNAI1-GNB4-GNG4 complex | GNAI1GNB4GNG4 | P50150P63096Q9HAV0 | 0:0:0 | CORUM | CORUM:7034 | 25733868 |
| GNAI1-GNB4-GNG8 complex | GNAI1GNB4GNG8 | P63096Q9HAV0Q9UK08 | 0:0:0 | CORUM | CORUM:7074 | 25733868 |
| GNAI1-GNB4-GNGT1 complex | GNAI1GNB4GNGT1 | P63096P63211Q9HAV0 | 0:0:0 | CORUM | CORUM:7017 | 25733868 |
Sequence, Structure & Domains
Sequences
Length
340
Mass
37,567
Sequence
MSELEQLRQEAEQLRNQIQDARKACNDATLVQITSNMDSVGRIQMRTRRTLRGHLAKIYAMHWGYDSRLLVSASQDGKLIIWDSYTTNKMHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELPGHTGYLSCCRFLDDSQIVTSSGDTTCALWDIETAQQTTTFTGHSGDVMSLSLSPDMRTFVSGACDASSKLWDIRDGMCRQSFTGHVSDINAVSFFPNGYAFATGSDDATCRLFDLRADQELLLYSHDNIICGITSVAFSKSGRLLLAGYDDFNCNVWDTLKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLRIWN
Domain & Motif Annotations
Repeat
53..92; WD 1; 95..134; WD 2; 141..179; WD 3; 182..221; WD 4; 224..263; WD 5; 268..307; WD 6; 310..339; WD 7
Protein Families
WD repeat G protein beta family
Sequence Similarities
Belongs to the WD repeat G protein beta family.
Clinical Relevance
Disease Involvement (4)
Charcot-Marie-Tooth diseaseDisease variantNeurodegenerationNeuropathy
Related Diseases
Interaction Protein
ENSG00000078369
Interaction Count
1
Interaction Dataset
biogrid_opencell
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 32384937 | Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles. | No related sentences available |