Protein detail
IL21R
Interleukin-21 receptor (IL-21 receptor) (IL-21R) (Novel interleukin receptor) (CD antigen CD360)
Entry name IL21R | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification Cancer-related genesCD markersDisease related genesHuman disease related genesPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Interleukin-21 receptor (IL-21 receptor) (IL-21R) (Novel interleukin receptor) (CD antigen CD360)
Protein Class (5)
Cancer-related genesCD markersDisease related genesHuman disease related genesPredicted membrane proteins
Protein Function (4)
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Disease related genes
- CD markers
- Cancer-related genes
Transmembrane
233..253; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym
CD360
Gene Description
Interleukin 21 receptor
Chromosome
16
Position
27402174-27452042
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization6
Tissue SpecificbrainBrain Regional SpecificcerebellumSingle-Nuclei Brain Specificupper rhombic lipSecretome LocationSecreted to extracellular matrixSecretome FunctionCell adhesion
Function & Pathway7
Protein Function (4)
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Disease related genes
- CD markers
- Cancer-related genes
Cellular Component (3)
Molecular Function (4)
Biological Process (3)
KEGG (4)
Reactome (4)
Mediation Categories (3)
Clinical-translation mediationFusion and delivery mediationImmune mediation
Relations & Evidence60
Ligand-Receptor Signaling (54)
54 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | No | Yes | No | Yes | No |
| extracellular | extracellular | HPMR | No | No | No | Yes | No |
| extracellular | extracellular | DGIdb | No | No | No | Yes | No |
| extracellular | extracellular | OmniPath | No | No | No | Yes | No |
| intracellular | intracellular | LOCATE | No | No | No | Yes | No |
| intracellular | intracellular | OmniPath | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | Yes | No |
| transmembrane | transmembrane | GO_Intercell | No | No | No | Yes | No |
Regulatory Interaction Network (3)
3 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| IL21R | Q9HBE5 | JAK1 | P23458 | Yes | Yes | No | InnateDB_SignaLink3SIGNORHPRDHINTSignaLink3InnateDBWang | SignaLink3:11418623HPRD:11016959InnateDB:11016959HINT:11016959SignaLink3:11016959HINT:11418623SIGNOR:12093291SignaLink3:23180781SignaLink3:23331499HPRD:11418623 |
| IL21 | Q9HBE4 | IL21R | Q9HBE5 | Yes | Yes | No | iTALKSIGNORHINTSignaLink3UniProt_LRdbHPMR_talklrHPMRHPRD_LRdbtalklrHPRDRamilowski2015_Baccin2019WangRamilowski2015HPMR_LRdbHPRD_talklrBaccin2019STRING_talklrCellCallGuide2PharmaFantom5_LRdbCellTalkDBconnectomeDB2020LRdb | SignaLink3:18988627SignaLink3:11418623connectomeDB2020:11418623HINT:22235133HPMR:11418623HPRD:11418623SignaLink3:16424177SignaLink3:23331499HINT:37339051SIGNOR:16424177LRdb:11418623CellTalkDB:11418623SignaLink3:21071413Baccin2019:1141862311418620 |
| IL21R | Q9HBE5 | JAK3 | P52333 | Yes | Yes | No | WangSIGNORSignaLink3 | SignaLink3:12093291SIGNOR:12093291SignaLink3:23331499 |
Protein Complex Composition (2)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry;RNA Sequencing;Flow cytometry | 1 | 41307968 |
Sequence, Structure & Domains13
Sequences
Length
538
Mass
59,130
Sequence
MPRGWAAPLLLLLLQGGWGCPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKPAPPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKEGWNPHLLLLLLLVIVFIPAFWSLKTHPLWRLWKKIWAVPSPERFFMPLYKGCSGDFKKWVGAPFTGSSLELGPWSPEVPSTLEVYSCHPPRSPAKRLQLTELQEPAELVESDGVPKPSFWPTAQNSGGSAYSEERDRPYGLVSIDTVTVLDAEGPCTWPCSCEDDGYPALDLDAGLEPSPGLEDPLLDAGTTVLSCGCVSAGSPGLGGPLGSLLDRLKPPLADGEDWAGGLPWGGRSPGGVSESEAGSPLAGLDMDTFDSGFVGSDCSSPVECDFTSPGDEGPPRSYLRQWVVIPPPLSSPGPQAS
3D Structural Models
Turn
206..209
Helix
85..87; 114..116; 141..143; 145..150; 187..189
Beta Strand
24..27; 29..38; 41..43; 46..52; 57..59; 64..72; 74..82; 93..99; 101..104; 106..113; 124..127; 130..139; 154..165; 172..176; 181..185; 195..204; 221..224
3D Structure
X-ray crystallography (5)
Domain & Motif Annotations
Motif
214..218; WSXWS motif; 266..274; Box 1 motif
Domain (CC)
The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.; DOMAIN: The box 1 motif is required for JAK interaction and/or activation.
Domain (FT)
21..118; Fibronectin type-III 1; 119..228; Fibronectin type-III 2
Region
342..367; Disordered; 457..487; Disordered
Protein Families (2)
- Type I cytokine receptor family
- Type 4 subfamily
Sequence Similarities
Belongs to the type I cytokine receptor family. Type 4 subfamily.
Clinical Relevance5
Disease Involvement (2)
Cancer-related genesDisease variant
Related Diseases (3)
Biomarker
Phase 1; Phase 2
Antibody
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 32795414 | Extracellular Vesicle and Particle Biomarkers Define Multiple Human Cancers. | Among traditional exosome markers, CD9, HSPA8, ALIX, and HSP90AB1 represent pan-EVP markers, while ACTB, MSN, and RAP1B are novel pan-EVP markers. |