Protein detail
LY9
T-lymphocyte surface antigen Ly-9 (Cell surface molecule Ly-9) (Lymphocyte antigen 9) (SLAM family member 3) (SLAMF3) (Signaling lymphocytic activation molecule 3) (CD antigen CD229)
Entry name LY9 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification CD markersPredicted membrane proteinsPredicted secreted proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
T-lymphocyte surface antigen Ly-9 (Cell surface molecule Ly-9) (Lymphocyte antigen 9) (SLAM family member 3) (SLAMF3) (Signaling lymphocytic activation molecule 3) (CD antigen CD229)
Protein Class (3)
CD markersPredicted membrane proteinsPredicted secreted proteins
Protein Function (2)
- Predicted secreted proteins
- CD markers
Transmembrane
455..476; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (4)
CD229hly9mLY9SLAMF3
Gene Description
Lymphocyte antigen 9
Chromosome
1
Position
160796074-160828261
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization3
Cell SpecificcDCSingle-Nuclei Brain Specificcentral nervous system macrophage
Function & Pathway6
Protein Function (2)
- Predicted secreted proteins
- CD markers
Cellular Component (2)
Molecular Function
Biological Process (3)
Mediation Categories (2)
Fusion and delivery mediationImmune mediation
Relations & Evidence33
Ligand-Receptor Signaling (32)
32 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | No | Yes | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | Yes | No |
| transmembrane | transmembrane | TopDB | No | No | No | Yes | No |
| transmembrane | transmembrane | LOCATE | No | No | No | Yes | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | Yes | No |
| transmembrane | transmembrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | Cellinker | No | No | No | Yes | No |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Immunofluorescence | 1 | 35007697 |
Sequence, Structure & Domains10
Sequences
Length
655
Mass
72,139
Sequence
MVAPKSHTDDWAPGPFSSKPQRSQLQIFSSVLQTSLLFLLMGLRASGKDSAPTVVSGILGGSVTLPLNISVDTEIENVIWIGPKNALAFARPKENVTIMVKSYLGRLDITKWSYSLCISNLTLNDAGSYKAQINQRNFEVTTEEEFTLFVYEQLQEPQVTMKSVKVSENFSCNITLMCSVKGAEKSVLYSWTPREPHASESNGGSILTVSRTPCDPDLPYICTAQNPVSQRSSLPVHVGQFCTDPGASRGGTTGETVVGVLGEPVTLPLALPACRDTEKVVWLFNTSIISKEREEAATADPLIKSRDPYKNRVWVSSQDCSLKISQLKIEDAGPYHAYVCSEASSVTSMTHVTLLIYRRLRKPKITWSLRHSEDGICRISLTCSVEDGGNTVMYTWTPLQKEAVVSQGESHLNVSWRSSENHPNLTCTASNPVSRSSHQFLSENICSGPERNTKLWIGLFLMVCLLCVGIFSWCIWKRKGRCSVPAFCSSQAEAPADTPEPTAGHTLYSVLSQGYEKLDTPLRPARQQPTPTSDSSSDSNLTTEEDEDRPEVHKPISGRYEVFDQVTQEGAGHDPAPEGQADYDPVTPYVTEVESVVGENTMYAQVFNLQGKTPVSQKEESSATIYCSIRKPQVVPPPQQNDLEIPESPTYENFT
Alternative Products
Event=Alternative splicing; Named isoforms=4; Comment=Experimental confirmation may be lacking for some isoforms.; Name=1; IsoId=Q9HBG7-1; Sequence=Displayed; Name=2; IsoId=Q9HBG7-2; Sequence=VSP_002525; Name=3; IsoId=Q9HBG7-3; Sequence=VSP_002524, VSP_002525, VSP_002526; Name=4; IsoId=Q9HBG7-4; Sequence=VSP_043328
Alternative Sequence
152..193; EQLQEPQVTMKSVKVSENFSCNITLMCSVKGAEKSVLYSWTP -> APFIEKLSVHVIEGDHRTLLEGSGLESIISTLAEPRVSVREG (in isoform 4); 359..448; Missing (in isoform 3); 500..513; Missing (in isoform 2 and isoform 3); 524..554; PARQQPTPTSDSSSDSNLTTEEDEDRPEVHK -> Q (in isoform 3)
Domain & Motif Annotations
Compositional Bias
530..542; Low complexity
Motif
601..606; ITSM 1; 624..629; ITSM 2
Domain (CC)
The ITSMs (immunoreceptor tyrosine-based switch motifs) with the consensus sequence T-X-Y-X-X-[VI] present in SLAM family receptors have overlapping specificity for activating and inhibitory SH2 domain-containing binding partners. Especially they mediate the interaction with the SH2 domain of SH2D1A and SH2D1B. A 'three-pronged' mechanism is proposed involving threonine (position -2), phosphorylated tyrosine (position 0) and valine/isoleucine (position +3).
Domain (FT)
48..158; Ig-like V-type 1; 159..235; Ig-like C2-type 1; 251..363; Ig-like V-type 2; 364..452; Ig-like C2-type 2
Region
521..556; Disordered; 633..655; Disordered
Clinical Relevance1
Antibody
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 32396726 | Plasma-Derived Extracellular Vesicle Phosphoproteomics through Chemical Affinity Purification. | No abstract available |