EV MemProt Atlas

Basic Information11

Protein Names

Beta-parvin (Affixin)

Protein Class (4)

Cancer-related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins

Protein Function (2)

Cancer-related genes:Candidate cancer biomarkers
Predicted intracellular proteins

Ensembl

ENSG00000188677

Entrez Gene Symbol

PARVB

Gene Synonym

CGI-56

Gene Description

Parvin beta

Chromosome

22

Position

43999211-44172939

Supporting publications (n)

55

EVMP confidence score

0.88

Fluorescence & Localization1

Function & Pathway7

Protein Function (2)

Cancer-related genes:Candidate cancer biomarkers
Predicted intracellular proteins

Cellular Component (7)

Molecular Function (2)

Biological Process (3)

KEGG (2)

Reactome (4)

Mediation Categories (2)

Adhesion and uptake mediationReceptor-signaling mediation

Relations & Evidence25

Ligand-Receptor Signaling (12)

12 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
parin_adhesion_regulator	intracellular_intercellular_related	HGNC	Yes	No	No	No	No
adhesion_cytoskeleton_adaptor	intracellular_intercellular_related	Adhesome	Yes	No	No	No	No
intracellular_intercellular_related	intracellular_intercellular_related	OmniPath	Yes	No	No	No	No
transmembrane	transmembrane	Ramilowski_location	No	No	No	No	No
transmembrane	transmembrane	OmniPath	No	No	No	No	No

Page 1 of 2Next

Regulatory Interaction Network (1)

1 record.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
ILK	Q13418	PARVB	Q9HBI1	Yes	Yes	No	WangAdhesomePhosphoPointSIGNORHPRDHINTIntActSPIKE_LC	HPRD:15467740 SPIKE_LC:17145710 HINT:32707033 HINT:11402068 Adhesome:11402068 Adhesome:23612611 HINT:15467740 HINT:17353931 Adhesome:18325335 HINT:35271311 Adhesome:10592173 SPIKE_LC:17353931 HINT:26496610 HINT:33961781 IntAct:17353931 Adhesome:19798050 Adhesome:17353931 Adhesome:15467740 HPRD:11402068 SIGNOR:15159419

Protein Complex Composition (11)

11 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	PARVB	Q9HBI1	6	PDB	PDB:4edmPDB:4edl

Page 2 of 2Previous

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Fetch_Error	Western blottingMass spectrometryFACSWestern blotting\|Immunoelectron Microscopy\|FACSImmunoelectron MicroscopyFACS\|Immunoelectron MicroscopyWestern blotting\|FACSImmunoelectron Microscopy\|FACS\|Western blottingImmunoelectron Microscopy\|FACSWestern blotting\|FACS\|ELISAImmunofluorescence\|Western blotting\|FACSImmunoelectron microscopyMass spectrometry [LTQ-FT Ultra]\|Western blottingMass spectrometry\|Western blottingR SequencingWestern blotting\|Flow cytometric alysis\|Mass spectrometryWestern blotting\|Mass spectrometryWestern blotting\|ImmunofluorescenceFlow cytometryImmunofluorescenceWestern blotting\|immuno-EMMORPHELISAWestern blotting\|Immuno-EMImmuno-EM	765	35025388 33358817 33345458 33344443 33334882 33328332 33325145 33313243 33307173 33300228 33275138 33269813 33261145 33250449 33198173 33182773 33169756 33155413 33148515 33101656 33075328 33059952 33049740 33037627 33024173 33023058 33011724 32944195 32930202 32919211 32890627 32876972 32871743 32841894 32820307 32801874 32793278 32730952 32676813 32659447 32641688 32635856 32630723 32607862 32597834 32589377 32546618 32542981 32506769 32495928 32487603 32483153 32463402 32439052 32429185 32424440 32375155 32368986 32350913 32350252 32342086 32338917 32328746 32322309 32318822 32282497 32278412 32274858 32269736 32244842 32240782 32232928 32232575 32207293 32178271 32166281 32157871 32157172 32151262 32127037 32126572 32101370 32073129 32071462 32056961 32054015 32039741 32028167 31998080 31995983 31973741 31968209 31934115 31930553 31907155 31897558 31878991 31858380 31820935 31800531 31792471 31786017 31766102 31753050 31749189 31743567 31736169 31713717 31712601 31676071 31675489 31666406 31665020 31660712 31647995 31641193 31611757 31594209 31558796 31537868 31536072 31507456 31473497 31469590 31441625 31416445 31410448 31407387 31403149 31402975 31401476 31400579 31399634 31385692 31376716 31366487 31349735 31339911 31331170 31298362 31275379 31268344 31258635 31242249 31220525 31200334 31196738 31168974 31136209 31097475 31081293 31070244 31068294 31035355 31022607 31015841 31012118 30990781 30989714 30963720 30917536 30906967 30901906 30891102 30890238 30850633 30820789 30777349 30775228 30768610 30745143 30733650 30716336 30680751 30678441 30668697 30642589 30639393 30626897 30622695 30613011 30236130 30234974 30232365 30222750 30198786 30188455 30187874 30178196 30142333 30098419 30043563 30032860 30021922 30021360 30021215 29986939 29950415 29945314 29933408 29911857 29884196 29875202 29846695 29802284 29786755 29740437 29740045 29723143 29720199 29719295 29718044 29675371 29674035 29635386 29626979 29575602 29539618 29518183 29484119 29468680 29452091 29450143 29430178 29416092 29404859 29385596 29381333 29339438 29336475 29329079 29293592 28956068 9685355 10572093 11150547 11487543 12766069 14582906 16023874 16027013 32127037 32151262 32157172 32274858 32290097 32375155 32766239 32876972 32890627 32944186 33037627 33059952 33075328 33313243 33386754 33413616 33420578 33497388 33530152 33544944 33558596 33565399 33643547 33649776 33669497 33673859 33717398 33724661 33725248 33747370 33766230 33794910 33803623 33808296 33809102 33831402 33833530 33906978 33908200 33920772 33925027 33929095 33965973 33971889 33991016 33993180 33995680 34012515 34028833 34065240 34071980 34074435 34083272 34093824 34122615 34126793 34128973 34133431 34138564 34164201 34173219 34181396 34181894 34205051 34229300 34232468 34236165 34265052 34278108 34278172 34282141 34284286 34284947 34285483 34296581 34298051 34314868 34321877 34335040 34366842 34383347 34384449 34407412 34423573 34434533 34440851 34442609 34454924 34462532 34473505 34505435 34517616 34527741 34530425 34542679 34551201 34559939 34562426 34567283 34567775 34616478 34632781 34635251 34645935 34656547 34684727 34686196 34698510 34707701 34710390 34739016 34742829 34745768 34769456 34800917 34811658 34847362 34863187 34874025 34900729 34926194 34926195 34939759 34947800 34954570 34999547 35006577 35008709 35047450 35053007 35057959 35072456 35084842 35085593 35124383 35127966 35158834 35164837 35175412 35175564 35182062 35228162 35234046 35249136 35259607 35273100 35278860 35297690 35301156 35314197 35321254 35330909 35333565 35345318 35350978 35371077 35373929 35377980 35394232 35409043 35414380 35424452 35432916 35448317 35485158 35496046 35496773 35497368 35511336 35552479 35576661 35592860 35619665 35623789 35628538 35639245 35655952 35657460 35689956 35695270 35698293 35700522 35708514 35716063 35728610 35732548 35786484 35816651 35820407 35854778 35896586 35899209 35922742 35923105 35930994 35957917 35988100 35988652 35995206 35999549 36055382 36060136 36063111 36063301 36080806 36093484 36105695 36108271 36115123 36119932 36136097 36150242 36190183 36219333 36225174 36240643 36275892 36308704 36312392 36325775 36335538 36353645 36359760 36395728 36411474 36466784 36550142 36565296 36581340 36585155 16027013 16407131 17894858 17949417 18930046 19190083 19381331 19810033 19949097 20052414 20218655 20880880 21044087 21142445 21172122 21235781 21326294 21505438 21527913 21660937 21835908 21915303 22017459 22620679 22895844 22921594 22998595 23085511 23107341 23230278 23318173 23402739 23516492 23521563 23585443 23645497 23749427 23861904 23990473 24009888 24058665 24069378 24146068 24269592 24288129 24335901 24393345 24428462 24450402 24569882 24614226 24662828 24722878 24825548 24848946 24896633 24905832 24911657 24914390 24952935 24976626 25099764 25104112 25214786 25237619 25317274 25319668 25338648 25473095 25609010 25650727 25711438 25732677 25735706 25822997 25833959 25843788 25849885 25865256 25881934 25890246 25928805 25975376 26000464 26047123 26064280 26109643 26139298 26241326 26345219 26447809 26452221 26497063 26512089 26517556 26578789 26690353 26754424 26780239 26893367 26904012 26908631 26956853 26973197 26992236 27048572 27066504 27107034 27122160 27129211 27232491 27246926 27278097 27317346 27329675 27333275 27336721 27343445 27356893 27372594 27421995 27438886 27443953 27464736 27492928 27536982 27542209 27559612 27592404 27657169 27697217 27716356 27722146 27765945 27779585 27856179 27882487 27903962 27974566 27977725 28025988 28076321 28088446 28102751 28114422 28116765 28129550 28161063 28167415 28251957 28346015 28350871 28360912 28485529 28507029 28534915 28542562 28629620 28679315 28695799 28701751 28708510 28740179 28740388 28762264 28770472 28771197 28819811 28847700 28849073 28850588 28851452 28878075 28878382 28928845 28930577 28934733 28956068 29023592 29046635 29073095 29116068 29191962 29194317 29212935 29241062 29265007 35006577 35053007 35249136 35259607 35260179 35732548 35786484 36189227 36203609 36240643 36308704 36312392 36359760 36585155 36611951 36653703 36685520 36692235 36704890 36715074 36736526 36741391 36759883 36777859 36814381 36815255 36826611 36924637 36929834 36945515 36947957 36982991 37009008 37014542 37042872 37106519 37125533 37142558 37198427 37207584 37226734 37276048 37307147 37345178 37368982 37386835 37422687 37445655 37543776 37639834 37960298 37978163 37984826 37989982 37991490 38006701 38069981 38072803 38151158 38199177 38247836 38261001 38277965 38279456 38303107 38314707 38341004 38342761 38354024 38400284 38409426 38430799 38439112 38472166 38567379 38590572 38591903 38624007 38627767 38630028 38684330 38718108 38754193 38783745 38785322 38785998 38830977 38842768 38851436 38874800 38876518 38886558 38922971 38938373 38978287 39002259 39093424 39147261 39157104 39178227 39191106 39222871 39230197 39246205 39255623 39299675 39305336

Sequence, Structure & Domains13

Sequences

Length

364

Mass

41,714

Sequence

MSSAPRSPTPRPRRMKKDESFLGKLGGTLARKRRAREVSDLQEEGKNAINSPMSPALVDVHPEDTQLEENEERTMIDPTSKEDPKFKELVKVLLDWINDVLVEERIIVKQLEEDLYDGQVLQKLLEKLAGCKLNVAEVTQSEIGQKQKLQTVLEAVHDLLRPRGWALRWSVDSIHGKNLVAILHLLVSLAMHFRAPIRLPEHVTVQVVVVRKREGLLHSSHISEELTTTTEMMMGRFERDAFDTLFDHAPDKLSVVKKSLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEDYFVPLHHFYLTPESFDQKVHNVSFAFELMLDGGLKKPKARPEDVVNLDLKSTLRVLYNLFTKYKNVE

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q9HBI1-1; Sequence=Displayed; Name=2; IsoId=Q9HBI1-2; Sequence=VSP_041336; Name=3; IsoId=Q9HBI1-3; Sequence=VSP_045555

Alternative Sequence

1..38; MSSAPRSPTPRPRRMKKDESFLGKLGGTLARKRRAREV -> M (in isoform 3); 1..37; MSSAPRSPTPRPRRMKKDESFLGKLGGTLARKRRARE -> MHHVFKDHQRGEKRGFLSPENKNCRRLELRRGCSCSWGLCSQALMASLAGSLLPGSDRSGVETSEYAQGG (in isoform 2)

3D Structural Models

Turn

278..284

Helix

243..246; 250..252; 254..268; 269..271; 286..295; 302..304; 312..328; 338..342; 346..360

3D Structure

X-ray crystallography (3)

Domain & Motif Annotations

Compositional Bias

36..46; Basic and acidic residues

Domain (FT)

87..194; Calponin-homology (CH) 1; 254..361; Calponin-homology (CH) 2

Region

1..57; Disordered

Protein Families

Parvin family

Sequence Similarities

Belongs to the parvin family.

Clinical Relevance5

Disease Involvement

Cancer-related genes

Antibody (2)

HPA003568 HPA072217

Interaction Protein

ENSG00000166333

Interaction Count

1

Interaction Dataset

intact_biogrid_opencell_bioplex

Supporting Publications55

PMID	Title	Abstract
40545963	Extracellular Vesicle Proteome Analysis Improves Diagnosis of Recurrence in Triple-Negative Breast Cancer.	No abstract available
40619995	A 96-Well Ultrafiltration Approach for the High-Throughput Proteome Analysis of Extracellular Vesicles Isolated From Conditioned Medium.	No abstract available
40750896	The exosomal protein biomarkers auxiliary in diagnosis of interstitial lung disease.	No abstract available
40945317	Comparing the proteome profiling of plasma-derived extracellular vesicles in individuals with schizophrenia and healthy controls: a pilot study.	No abstract available
41201090	Identification of molecular markers and exploration of the oncogenic role of exomeres in hepatocellular carcinoma.	No abstract available

Page 6 of 6Previous

Entry name PARVB	UniProt ID Q9HBI1	EVMP confidence score 0.88
Supporting publications (n) 55	Transmembrane count	Protein classification Cancer-related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins