Protein detail
LST2
Lateral signaling target protein 2 homolog (hLst2) (Zinc finger FYVE domain-containing protein 28)
Entry name LST2 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Plasma proteinsPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Lateral signaling target protein 2 homolog (hLst2) (Zinc finger FYVE domain-containing protein 28)
Protein Class (2)
Plasma proteinsPredicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
KIAA1643lst-2
Gene Description
Zinc finger FYVE-type containing 28
Chromosome
4
Position
2269582-2418651
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization1
Cell SpecificNeutrophil progenitors
Function & Pathway5
Protein Function
Predicted intracellular proteins
Cellular Component (2)
Molecular Function (3)
Biological Process (3)
Mediation Categories (2)
Fusion and delivery mediationReceptor-signaling mediation
Relations & Evidence13
Enzyme-Mediated Modification (2)
2 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| ZFYVE28 | MAP2K1 | Q02750 | S | 586 | phosphorylation | dbPTM | dbPTM:19460345 |
| ZFYVE28 | MAP2K1 | Q02750 | T | 870 | phosphorylation | dbPTM | dbPTM:19460345 |
Ligand-Receptor Signaling (8)
8 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| transmembrane | transmembrane | GO_Intercell | No | No | No | No | No |
| transmembrane | transmembrane | LOCATE | No | No | No | No | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | No | No |
| transmembrane | transmembrane | OmniPath | No | No | No | No | No |
Protein Complex Composition (2)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometryR Sequencing | 1 | 37285022 |
Sequence, Structure & Domains12
Sequences
Length
887
Mass
96,490
Sequence
MMNRFRKWLYKPKRSDPQLLARFYYADEELNQVAAELDSLDGRKDPQRCTLLVSQFRSCQDNVLNIINQIMDECIPQDRAPRDFCVKFPEEIRHDNLAGQLWFGAECLAAGSIIMNRELESMAMRPLAKELTRSLEDVRGALRDQALRDLNTYTEKMREALRHFDVLFAEFELSYVSAMVPVKSPREYYVQQEVIVLFCETVERALDFGYLTQDMIDDYEPALMFSIPRLAIVCGLVVYADGPLNLDRKVEDMSELFRPFHTLLRKIRDLLQTLTEEELHTLERNLCISQDVEFPIRADVQGPAALAPALSAPLPPEGPLSAKAKDPDAELACSMQYDDQELEQLSRMVHRAGDEMSSLLSPPIACQSPAHRPGAEGSPGGEASPGRPRLRSGSDEEERVFFMDDVEGTAEALARPESPAGPFGWAGSTWADPQEKGQGGPGGAAGISLPASEKEEDLSNNNLEAEGTDGASLAGTSSCSCLDSRLHLDGWEVGADDAETAEMIAHRTGGMKLSATVIFNPKSPTSLDSAVATQEAASEPVAEGMDGGPHKLSTGATNCLLHSCVCCGSCGDSREDVVERLREKCSPGGVIGASYAAGLAKASDRAPERQEEAPPPSEDASNGREPKAPTSDKCLPHTSGSQVDTASGLQGEAGVAGQQEPEARELHAGSPSAHEAPQALSGSSSSTAGSCSSDKMGPEAAPAATHAAPQATREKIRSRFHGSHDLIHRLFVCISGVADQLQTNYASDLRSILKTLFEVMATKPETDDKEKLRKVTQTLRSAALEDCALCQETLSSSELAAKTRDGDFEDPPEWVPDEACGFCTACKAPFTVIRRKHHCRSCGKIFCSRCSSHSAPLPRYGQVKPVRVCTHCYMFHVTPFYSDKAGL
Alternative Products
Event=Alternative splicing; Named isoforms=8; Name=1; IsoId=Q9HCC9-1; Sequence=Displayed; Name=2; IsoId=Q9HCC9-2; Sequence=VSP_037616; Name=3; IsoId=Q9HCC9-3; Sequence=VSP_037615; Name=4; IsoId=Q9HCC9-4; Sequence=VSP_037615, VSP_037616; Name=5; IsoId=Q9HCC9-5; Sequence=VSP_037614; Name=6; IsoId=Q9HCC9-6; Sequence=VSP_045805, VSP_045806; Name=7; IsoId=Q9HCC9-7; Sequence=VSP_046092, VSP_046093, VSP_046094; Name=8; IsoId=Q9HCC9-8; Sequence=VSP_037615, VSP_046379
Alternative Sequence
1..114; Missing (in isoform 5); 1..70; Missing (in isoform 3, isoform 4 and isoform 8); 14..60; Missing (in isoform 7); 204..234; RALDFGYLTQDMIDDYEPALMFSIPRLAIVC -> S (in isoform 2 and isoform 4); 205..219; ALDFGYLTQDMIDDY -> NGKGVLKFMWNCNGP (in isoform 7); 220..887; Missing (in isoform 7); 234..887; Missing (in isoform 8); 235..287; GLVVYADGPLNLDRKVEDMSELFRPFHTLLRKIRDLLQTLTEEELHTLERNLC -> PLLPAHPRTRAGATAHVACRMVAGSSSGALTHPPVSKQGVISALLRPLPELPP (in isoform 6); 288..887; Missing (in isoform 6)
3D Structural Models
3D Structure
Electron microscopy (4)
Domain & Motif Annotations
Compositional Bias
602..612; Basic and acidic residues; 638..648; Polar residues; 681..693; Low complexity; 700..711; Low complexity
Zinc Finger
817..879; FYVE-type
Domain (CC)
The FYVE-type zinc finger mediates the interaction with phosphatidylinositol 3-phosphate (PI3P) and localization to early endosome membranes when not monoubiquitinated at Lys-87..
Region
308..327; Disordered; 354..396; Disordered; 412..474; Disordered; 599..714; Disordered
Protein Families
Lst-2 family
Sequence Similarities
Belongs to the lst-2 family.
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 28914500 | Comprehensive proteomics analysis of exosomes derived from human seminal plasma. | No abstract available |