Protein detail
ROBO2
Roundabout homolog 2
Entry name ROBO2 | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 3 | Transmembrane count 1 | Protein classification Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Roundabout homolog 2
Protein Class (5)
Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins
Protein Function (3)
- Disease related genes
- Human disease related genes:Urinary system diseases:Kidney diseases
- Predicted intracellular proteins
Transmembrane
860..880; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym
KIAA1568
Gene Description
Roundabout guidance receptor 2
Chromosome
3
Position
75906695-77649964
Supporting publications (n)
3
EVMP confidence score
0.40
Fluorescence & Localization
Tissue Specificskeletal muscleCell SpecificAdipocytes
Function & Pathway
Protein Function (3)
- Disease related genes
- Human disease related genes:Urinary system diseases:Kidney diseases
- Predicted intracellular proteins
Cellular Component (4)
Molecular Function (3)
Biological Process (3)
Reactome (7)
- R-hsa-9830674 formation of the ureteric bud
- R-hsa-9830369 kidney development
- R-hsa-9675108 nervous system development
- R-hsa-428542 regulation of commissural axon pathfinding by slit and robo
- R-hsa-9010553 regulation of expression of slits and robos
- R-hsa-9010642 robo receptors bind akap5
- R-hsa-376176 signaling by robo receptors
Mediation Categories
Adhesion and uptake mediation
Relations & Evidence52
Ligand-Receptor Signaling (48)
48 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| cell_surface_ligand | cell_surface_ligand | OmniPath | Yes | Yes | |||
| adhesion | adhesion | HGNC | Yes | Yes | Yes | ||
| cell_adhesion | cell_adhesion | HGNC | Yes | Yes | Yes | ||
| adhesion | adhesion | OmniPath | Yes | Yes | Yes | ||
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | Yes | ||
| transmembrane | transmembrane | UniProt_location | Yes | ||||
| transmembrane | transmembrane | UniProt_topology | Yes | ||||
| transmembrane | transmembrane | UniProt_keyword | Yes | ||||
| transmembrane | transmembrane | GO_Intercell | Yes | ||||
| transmembrane | transmembrane | CellPhoneDB | Yes |
Regulatory Interaction Network (2)
2 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| SLIT2 | O94813 | ROBO2 | Q9HCK4 | Yes | Yes | iTALKSIGNORHPMR_talklrHPMRCellChatDBHPRD_LRdbtalklrHPRDWangRamilowski2015HPMR_LRdbCellPhoneDBHPRD_talklrCellinkerCellTalkDBFantom5_LRdbHPMR_CellinkerconnectomeDB2020LRdb | CellChatDB:10102268Cellinker:10102268Cellinker:31217826CellTalkDB:15130495Cellinker:29317497connectomeDB2020:15130495Cellinker:15130495HPMR:14761655connectomeDB2020:10102268SIGNOR:16226035HPRD:10102268LRdb:1HPMR:15130495LRdb:15130495 | |
| ROBO2 | Q9HCK4 | COF1 | P23528 | Yes | Yes | SIGNOR | SIGNOR:16226035 |
Protein Complex Composition (1)
Sequence, Structure & Domains
Sequences
Length
1,378
Mass
151,200
Sequence
MSLLMFTQLLLCGFLYVRVDGSRLRQEDFPPRIVEHPSDVIVSKGEPTTLNCKAEGRPTPTIEWYKDGERVETDKDDPRSHRMLLPSGSLFFLRIVHGRRSKPDEGSYVCVARNYLGEAVSRNASLEVALLRDDFRQNPTDVVVAAGEPAILECQPPRGHPEPTIYWKKDKVRIDDKEERISIRGGKLMISNTRKSDAGMYTCVGTNMVGERDSDPAELTVFERPTFLRRPINQVVLEEEAVEFRCQVQGDPQPTVRWKKDDADLPRGRYDIKDDYTLRIKKTMSTDEGTYMCIAENRVGKMEASATLTVRAPPQFVVRPRDQIVAQGRTVTFPCETKGNPQPAVFWQKEGSQNLLFPNQPQQPNSRCSVSPTGDLTITNIQRSDAGYYICQALTVAGSILAKAQLEVTDVLTDRPPPIILQGPANQTLAVDGTALLKCKATGDPLPVISWLKEGFTFPGRDPRATIQEQGTLQIKNLRISDTGTYTCVATSSSGETSWSAVLDVTESGATISKNYDLSDLPGPPSKPQVTDVTKNSVTLSWQPGTPGTLPASAYIIEAFSQSVSNSWQTVANHVKTTLYTVRGLRPNTIYLFMVRAINPQGLSDPSPMSDPVRTQDISPPAQGVDHRQVQKELGDVLVRLHNPVVLTPTTVQVTWTVDRQPQFIQGYRVMYRQTSGLQATSSWQNLDAKVPTERSAVLVNLKKGVTYEIKVRPYFNEFQGMDSESKTVRTTEEAPSAPPQSVTVLTVGSYNSTSISVSWDPPPPDHQNGIIQEYKIWCLGNETRFHINKTVDAAIRSVIIGGLFPGIQYRVEVAASTSAGVGVKSEPQPIIIGRRNEVVITENNNSITEQITDVVKQPAFIAGIGGACWVILMGFSIWLYWRRKKRKGLSNYAVTFQRGDGGLMSNGSRPGLLNAGDPSYPWLADSWPATSLPVNNSNSGPNEIGNFGRGDVLPPVPGQGDKTATMLSDGAIYSSIDFTTKTSYNSSSQITQATPYATTQILHSNSIHELAVDLPDPQWKSSIQQKTDLMGFGYSLPDQNKGNNGGKGGKKKKNKNSSKPQKNNGSTWANVPLPPPPVQPLPGTELEHYAVEQQENGYDSDSWCPPLPVQTYLHQGLEDELEEDDDRVPTPPVRGVASSPAISFGQQSTATLTPSPREEMQPMLQAHLDELTRAYQFDIAKQTWHIQSNNQPPQPPVPPLGYVSGALISDLETDVADDDADDEEEALEIPRPLRALDQTPGSSMDNLDSSVTGKAFTSSQRPRPTSPFSTDSNTSAALSQSQRPRPTKKHKGGRMDQQPALPHRREGMTDEEALVPYSKPSFPSPGGHSSSGTASSKGSTGPRKTEVLRAGHQRNASDLLDIGYMGSNSQGQFTGEL
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q9HCK4-1; Sequence=Displayed; Name=2; IsoId=Q9HCK4-2; Sequence=VSP_010647; Name=3; IsoId=Q9HCK4-3; Sequence=VSP_043394
Alternative Sequence
1..20; MSLLMFTQLLLCGFLYVRVD -> MARRHERVTRRMWTWAPGLLMMTVVFWGHQGNGQGQ (in isoform 3); 1186..1378; Missing (in isoform 2)
3D Structural Models
Turn
267..269; 562..564; 680..682
Helix
195..197; 285..287; 383..385; 480..482; 630..636
Beta Strand
142..145; 150..153; 159..161; 164..169; 181..184; 187..190; 199..207; 210..213; 217..229; 234..240; 242..244; 247..252; 255..260; 274..276; 278..282; 289..297; 300..311; 312..318; 323..326; 331..333; 336..341; 345..349; 367..370; 376..378; 387..394; 399..409; 419..422; 427..430; 434..437; 440..442; 448..453; 456..458; 464..467; 469..471; 473..477; 484..492; 495..508; 529..533; 538..541; 548..550; 554..561; 565..575; 577..582; 590..599; 602..606; 639..641; 651..660; 667..679; 685..688; 696..701; 704..718; 727..731
3D Structure
NMR spectroscopy (3); X-ray crystallography (3)
Domain & Motif Annotations
Compositional Bias
1058..1067; Low complexity; 1141..1155; Polar residues; 1215..1228; Acidic residues; 1240..1285; Polar residues; 1319..1343; Low complexity
Domain (FT)
31..127; Ig-like C2-type 1; 133..220; Ig-like C2-type 2; 225..309; Ig-like C2-type 3; 314..409; Ig-like C2-type 4; 418..504; Ig-like C2-type 5; 524..618; Fibronectin type-III 1; 637..735; Fibronectin type-III 2; 739..836; Fibronectin type-III 3
Region
603..625; Disordered; 1032..1084; Disordered; 1124..1156; Disordered; 1215..1348; Disordered
Protein Families (2)
- Immunoglobulin superfamily
- ROBO family
Sequence Similarities
Belongs to the immunoglobulin superfamily. ROBO family.
Supporting Publications3
| PMID | Title | Related sentences |
|---|---|---|
| 27487081 | Comparative Proteomic Analysis of Extracellular Vesicles Isolated by Acoustic Trapping or Differential Centrifugation. | No related sentences available |
| 36497184 | Oxidative Stress and Extracellular Matrix Remodeling Are Signature Pathways of Extracellular Vesicles Released upon Morphine Exposure on Human Brain Microvascular Endothelial Cells. | No related sentences available |
| 38207106 | Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity. | No related sentences available |