Protein detail

ROBO2

Roundabout homolog 2

Entry name ROBO2	UniProt ID Q9HCK4	EVMP confidence score 0.50
Supporting publications (n) 3	Transmembrane count 1	Protein classification Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Roundabout homolog 2

Protein Class (5)

Disease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins

Protein Function (3)

Disease related genes
Human disease related genes:Urinary system diseases:Kidney diseases
Predicted intracellular proteins

Transmembrane

860..880; Helical

Transmembrane Count

Ensembl

ENSG00000185008

Entrez Gene Symbol

ROBO2

Gene Synonym

KIAA1568

Gene Description

Roundabout guidance receptor 2

Chromosome

Position

75906695-77649964

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization3

Tissue Specificskeletal muscleCell SpecificAdipocytes

Function & Pathway7

Protein Function (3)

Disease related genes
Human disease related genes:Urinary system diseases:Kidney diseases
Predicted intracellular proteins

Cellular Component (4)

Molecular Function (3)

Biological Process (3)

KEGG (2)

Reactome (7)

Mediation Categories

Adhesion and uptake mediation

Relations & Evidence52

Ligand-Receptor Signaling (48)

48 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
cell_surface_ligand	cell_surface_ligand	OmniPath	Yes	No	No	Yes	No
adhesion	adhesion	HGNC	Yes	Yes	No	Yes	No
cell_adhesion	cell_adhesion	HGNC	Yes	Yes	No	Yes	No
adhesion	adhesion	OmniPath	Yes	Yes	No	Yes	No
cell_adhesion	cell_adhesion	OmniPath	Yes	Yes	No	Yes	No
transmembrane	transmembrane	UniProt_location	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_topology	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_keyword	No	No	No	Yes	No
transmembrane	transmembrane	GO_Intercell	No	No	No	Yes	No
transmembrane	transmembrane	CellPhoneDB	No	No	No	Yes	No

Page 3 of 5Previous Next

Regulatory Interaction Network (2)

2 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
SLIT2	O94813	ROBO2	Q9HCK4	Yes	Yes	No	iTALKSIGNORHPMR_talklrHPMRCellChatDBHPRD_LRdbtalklrHPRDWangRamilowski2015HPMR_LRdbCellPhoneDBHPRD_talklrCellinkerCellTalkDBFantom5_LRdbHPMR_CellinkerconnectomeDB2020LRdb	CellChatDB:10102268 Cellinker:10102268 Cellinker:31217826 CellTalkDB:15130495 Cellinker:29317497 connectomeDB2020:15130495 Cellinker:15130495 HPMR:14761655 connectomeDB2020:10102268 SIGNOR:16226035 HPRD:10102268LRdb:1HPMR:15130495 LRdb:15130495
ROBO2	Q9HCK4	COF1	P23528	Yes	Yes	No	SIGNOR	SIGNOR:16226035

Protein Complex Composition (1)

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	ROBO2	Q9HCK4	2	PDB	PDB:6iaaPDB:6i9s

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential Ultracentrifugation	Single Molecule Array；Western blotting	3	29889559 37673813 38257772

Sequence, Structure & Domains14

Sequences

Length

1,378

Mass

151,200

Sequence

MSLLMFTQLLLCGFLYVRVDGSRLRQEDFPPRIVEHPSDVIVSKGEPTTLNCKAEGRPTPTIEWYKDGERVETDKDDPRSHRMLLPSGSLFFLRIVHGRRSKPDEGSYVCVARNYLGEAVSRNASLEVALLRDDFRQNPTDVVVAAGEPAILECQPPRGHPEPTIYWKKDKVRIDDKEERISIRGGKLMISNTRKSDAGMYTCVGTNMVGERDSDPAELTVFERPTFLRRPINQVVLEEEAVEFRCQVQGDPQPTVRWKKDDADLPRGRYDIKDDYTLRIKKTMSTDEGTYMCIAENRVGKMEASATLTVRAPPQFVVRPRDQIVAQGRTVTFPCETKGNPQPAVFWQKEGSQNLLFPNQPQQPNSRCSVSPTGDLTITNIQRSDAGYYICQALTVAGSILAKAQLEVTDVLTDRPPPIILQGPANQTLAVDGTALLKCKATGDPLPVISWLKEGFTFPGRDPRATIQEQGTLQIKNLRISDTGTYTCVATSSSGETSWSAVLDVTESGATISKNYDLSDLPGPPSKPQVTDVTKNSVTLSWQPGTPGTLPASAYIIEAFSQSVSNSWQTVANHVKTTLYTVRGLRPNTIYLFMVRAINPQGLSDPSPMSDPVRTQDISPPAQGVDHRQVQKELGDVLVRLHNPVVLTPTTVQVTWTVDRQPQFIQGYRVMYRQTSGLQATSSWQNLDAKVPTERSAVLVNLKKGVTYEIKVRPYFNEFQGMDSESKTVRTTEEAPSAPPQSVTVLTVGSYNSTSISVSWDPPPPDHQNGIIQEYKIWCLGNETRFHINKTVDAAIRSVIIGGLFPGIQYRVEVAASTSAGVGVKSEPQPIIIGRRNEVVITENNNSITEQITDVVKQPAFIAGIGGACWVILMGFSIWLYWRRKKRKGLSNYAVTFQRGDGGLMSNGSRPGLLNAGDPSYPWLADSWPATSLPVNNSNSGPNEIGNFGRGDVLPPVPGQGDKTATMLSDGAIYSSIDFTTKTSYNSSSQITQATPYATTQILHSNSIHELAVDLPDPQWKSSIQQKTDLMGFGYSLPDQNKGNNGGKGGKKKKNKNSSKPQKNNGSTWANVPLPPPPVQPLPGTELEHYAVEQQENGYDSDSWCPPLPVQTYLHQGLEDELEEDDDRVPTPPVRGVASSPAISFGQQSTATLTPSPREEMQPMLQAHLDELTRAYQFDIAKQTWHIQSNNQPPQPPVPPLGYVSGALISDLETDVADDDADDEEEALEIPRPLRALDQTPGSSMDNLDSSVTGKAFTSSQRPRPTSPFSTDSNTSAALSQSQRPRPTKKHKGGRMDQQPALPHRREGMTDEEALVPYSKPSFPSPGGHSSSGTASSKGSTGPRKTEVLRAGHQRNASDLLDIGYMGSNSQGQFTGEL

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q9HCK4-1; Sequence=Displayed; Name=2; IsoId=Q9HCK4-2; Sequence=VSP_010647; Name=3; IsoId=Q9HCK4-3; Sequence=VSP_043394

Alternative Sequence

1..20; MSLLMFTQLLLCGFLYVRVD -> MARRHERVTRRMWTWAPGLLMMTVVFWGHQGNGQGQ (in isoform 3); 1186..1378; Missing (in isoform 2)

3D Structural Models

Turn

267..269; 562..564; 680..682

Helix

195..197; 285..287; 383..385; 480..482; 630..636

Beta Strand

142..145; 150..153; 159..161; 164..169; 181..184; 187..190; 199..207; 210..213; 217..229; 234..240; 242..244; 247..252; 255..260; 274..276; 278..282; 289..297; 300..311; 312..318; 323..326; 331..333; 336..341; 345..349; 367..370; 376..378; 387..394; 399..409; 419..422; 427..430; 434..437; 440..442; 448..453; 456..458; 464..467; 469..471; 473..477; 484..492; 495..508; 529..533; 538..541; 548..550; 554..561; 565..575; 577..582; 590..599; 602..606; 639..641; 651..660; 667..679; 685..688; 696..701; 704..718; 727..731

3D Structure

NMR spectroscopy (3); X-ray crystallography (3)

Domain & Motif Annotations

Compositional Bias

1058..1067; Low complexity; 1141..1155; Polar residues; 1215..1228; Acidic residues; 1240..1285; Polar residues; 1319..1343; Low complexity

Domain (FT)

31..127; Ig-like C2-type 1; 133..220; Ig-like C2-type 2; 225..309; Ig-like C2-type 3; 314..409; Ig-like C2-type 4; 418..504; Ig-like C2-type 5; 524..618; Fibronectin type-III 1; 637..735; Fibronectin type-III 2; 739..836; Fibronectin type-III 3

Region

603..625; Disordered; 1032..1084; Disordered; 1124..1156; Disordered; 1215..1348; Disordered

Protein Families (2)

Immunoglobulin superfamily
ROBO family

Sequence Similarities

Belongs to the immunoglobulin superfamily. ROBO family.

Clinical Relevance2

Disease Involvement

Disease variant

Antibody (2)

HPA013371 HPA014209

Supporting Publications3

PMID	Title	Abstract
27487081	Comparative Proteomic Analysis of Extracellular Vesicles Isolated by Acoustic Trapping or Differential Centrifugation.	No abstract available
36497184	Oxidative Stress and Extracellular Matrix Remodeling Are Signature Pathways of Extracellular Vesicles Released upon Morphine Exposure on Human Brain Microvascular Endothelial Cells.	No abstract available
38207106	Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity.	No abstract available