Protein detail
RAB18
Ras-related protein Rab-18 (EC 3.6.5.2)
Entry name RAB18 | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) | Transmembrane count | Protein classification Cancer-related genesDisease related genesHuman disease related genesPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information9
Protein Names
Ras-related protein Rab-18 (EC 3.6.5.2)
Protein Class (4)
Cancer-related genesDisease related genesHuman disease related genesPredicted intracellular proteins
Protein Function (4)
- Disease related genes
- Cancer-related genes:Candidate cancer biomarkers
- Human disease related genes:Congenital malformations:Congenital malformations of the nervous system
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Description
RAB18, member RAS oncogene family
Chromosome
10
Position
27504174-27543207
EVMP confidence score
0.38
Fluorescence & Localization1
Cell SpecificAdrenal medulla cells
Function & Pathway7
Protein Function (4)
- Disease related genes
- Cancer-related genes:Candidate cancer biomarkers
- Human disease related genes:Congenital malformations:Congenital malformations of the nervous system
- Predicted intracellular proteins
Cellular Component (9)
Molecular Function (4)
Biological Process (3)
Reactome (11)
- R-hsa-6811436 copi independent golgi to er retrograde traffic
- R-hsa-8856688 golgi to er retrograde transport
- R-hsa-168249 innate immune system
- R-hsa-6811442 intra golgi and retrograde golgi to er traffic
- R-hsa-199991 membrane trafficking
- R-hsa-6798695 neutrophil degranulation
- R-hsa-597592 post translational protein modification
- R-hsa-8876198 rab gefs exchange gtp for gdp on rabs
- R-hsa-8873719 rab geranylgeranylation
- R-hsa-9007101 rab regulation of trafficking
Page 1 of 2
Canonical Pathways (3)
- M233 Pid epo pathway
- M1315 Sig pip3 signaling in b lymphocytes
- M231 Pid kit pathway
Mediation Categories (4)
Fusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence10
Ligand-Receptor Signaling (7)
7 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| apical_cell_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
Protein Complex Composition (2)
2 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| HT_DM_Cluster78 | MVB12AMVB12BRAB18TSG101VPS28VPS37BVPS37CVPS37D | A5D8V6Q86XT2Q96EY5Q99816Q9H7P6Q9H9H4Q9NP72Q9UK41 | 1:1:1:1:1:1:1:1 | Compleat | Compleat:HC3597 | 22036573 |
| HT_SC_Cluster344 | RAB18RAB19RAB1ARAB1BRABIF | A4D1S5P47224P62820Q9H0U4Q9NP72 | 1:1:1:1:1 | Compleat | Compleat:HC2913 |
Sequence, Structure & Domains13
Sequences
Length
206
Mass
22,977
Sequence
MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACGGYCSVL
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q9NP72-1; Sequence=Displayed; Name=2; IsoId=Q9NP72-2; Sequence=VSP_043912; Name=3; IsoId=Q9NP72-3; Sequence=VSP_044883
Alternative Sequence
62; W -> WVTLHQQTANFFLKSQIGNSPILKWAMWQY (in isoform 2); 63..126; Missing (in isoform 3)
3D Structural Models
Turn
152..154
Helix
21..30; 68..70; 74..78; 93..97; 99..106; 133..142; 158..170; 173..175
Beta Strand
5..14; 42..52; 55..64; 83..89; 116..122; 126..128; 146..149
3D Structure
X-ray crystallography (1)
Domain & Motif Annotations
Motif
31..45; Switch 1; 63..80; Switch 2
Domain (CC)
Switch 1, switch 2 and the interswitch regions are characteristic of Rab GTPases and mediate the interactions with Rab downstream effectors. The switch regions undergo conformational changes upon nucleotide binding which drive interaction with specific sets of effector proteins, with most effectors only binding to GTP-bound Rab.
Protein Families (2)
- Small GTPase superfamily
- Rab family
Sequence Similarities
Belongs to the small GTPase superfamily. Rab family.
Clinical Relevance5
Disease Involvement
Cancer-related genes
Antibody
Interaction Protein
ENSG00000203879
Interaction Count
1
Interaction Dataset
biogrid_opencell_bioplex