Protein detail
KCNK9
Potassium channel subfamily K member 9 (Acid-sensitive potassium channel protein TASK-3) (TWIK-related acid-sensitive K(+) channel 3) (Two pore potassium channel KT3.2) (Two pore K(+) channel KT3.2)
Entry name KCNK9 | UniProt ID | EVMP score 0.50 |
Frequency 1 | Transmembrane count 4 | Protein classification |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Potassium channel subfamily K member 9 (Acid-sensitive potassium channel protein TASK-3) (TWIK-related acid-sensitive K(+) channel 3) (Two pore potassium channel KT3.2) (Two pore K(+) channel KT3.2)
Protein Function
- Voltage-gated ion channels:Two-P Potassium Channels
- Transporters:Transporter channels and pores
- Human disease related genes:Congenital malformations:Other congenital malformations
- Disease related genes
- FDA approved drug targets:Small molecule drugs
Transmembrane
9..29; Helical; 108..128; Helical; 159..179; Helical; 219..239; Helical
Transmembrane Count
4
Ensembl
Entrez Gene Symbol
Frequency
1
EVMP Score
0.50
Fluorescence & Localization
Cell SpecificEsophageal apical cellsSingle-Nuclei Brain Specificcentral nervous system macrophage
Function & Pathway
Protein Function
- Voltage-gated ion channels:Two-P Potassium Channels
- Transporters:Transporter channels and pores
- Human disease related genes:Congenital malformations:Other congenital malformations
- Disease related genes
- FDA approved drug targets:Small molecule drugs
Cellular Component
Molecular Function
Biological Process
Reactome
Canonical Pathways
- M212 Pid integrin5 pathway
- M185 Pid alk1 pathway
- M33 Pid glypican 1pathway
Mediation Categories
Fusion and delivery mediation
Relations & Evidence
Enzyme-Mediated Modification
2 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| KCNK9 | PRKACA | P17612 | S | 373 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:21357689 |
| KCNK9 | PRKCA | P17252 | T | 341 | phosphorylation | PhosphoSite |
Ligand-Receptor Signaling
24 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
| receptor | receptor | scConnect | No | Yes | No | No | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | No | No | No |
Page 3 of 3Previous
Regulatory Interaction Network
2 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| KAPCA | P17612 | KCNK9 | Q9NPC2 | Yes | Yes | No | PhosphoSite_MIMPMIMPPhosphoSite_norefSIGNORiPTMnetProtMapperSIGNOR_ProtMapperPhosphoSite_ProtMapper | SIGNOR:21357689ProtMapper:21357689 |
| KPCA | P17252 | KCNK9 | Q9NPC2 | Yes | No | No | PhosphoSitePhosphoSite_ProtMapperProtMapper | PhosphoSite:17374744 |
Protein Complex Composition
7 records.
Sequence, Structure & Domains
Sequences
Length
374
Mass
42,264
Sequence
MKRQNVRTLSLIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTDVSMENMVTVGFFSCMGTLCIGAAAFSQCEEWSFFHAYYYCFITLTTIGFGDYVALQTKGALQKKPLYVAFSFMYILVGLTVIGAFLNLVVLRFLTMNSEDERRDAEERASLAGNRNSMVIHIPEEPRPSRPRYKADVPDLQSVCSCTCYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSPISSISPGLHSFTDHQRLMKRRKSV
3D Structural Models
Helix
3..52; 56..73; 80..91; 104..146; 156..181; 186..197; 213..216; 218..247; 249..256
Beta Strand
77..79
3D Structure
Electron microscopy (6); X-ray crystallography (16)
Domain & Motif Annotations
Domain (CC)
Each subunit contributes two pore-forming domains 1 and 2 which assemble to form a single pore with M2 and M4 transmembrane helices lining the central cavity and M1 and M3 facing the lipid bilayer. The transmembrane helices are bridged by the selectivity filters 1 and 2 carrying a signature sequence TxTTxG(Y/F)G(D/H) that coordinate the permeant ions. Up to four ions can simultaneously occupy the selectivity filter and at least two elementary charges must translocate across the filter to convert it into the open conformation.; DOMAIN: The X-gate is positioned at the distal ends of M4 transmembrane helices forming a two-turn-helical structure with the methyl group of Thr-248 closing the ion conduction pathway.
Region
93..98; Selectivity filter 1; 199..204; Selectivity filter 2; 243..248; X-gate
Protein Families
Two pore domain potassium channel (TC 1.A.1.8) family
Sequence Similarities
Belongs to the two pore domain potassium channel (TC 1.A.1.8) family.