Protein detail
PLCB1
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 (EC 3.1.4.11) (PLC-154) (Phosphoinositide phospholipase C-beta-1) (Phospholipase C-I) (PLC-I) (Phospholipase C-beta-1) (PLC-beta-1)
Protein symbol PLCB1 | UniProt ID | EVMP score 0.50 |
Frequency 4 | Transmembrane count | Protein classification Disease related genesEnzymesHuman disease related genesMetabolic proteinsPlasma proteinsPotential drug targetsPredicted intracellular proteins |
Basic Information
Protein Names
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 (EC 3.1.4.11) (PLC-154) (Phosphoinositide phospholipase C-beta-1) (Phospholipase C-I) (PLC-I) (Phospholipase C-beta-1) (PLC-beta-1)
Protein Class
Disease related genesEnzymesHuman disease related genesMetabolic proteinsPlasma proteinsPotential drug targetsPredicted intracellular proteins
Protein Function
- Predicted intracellular proteins
- Human disease related genes:Nervous system diseases:Epilepsy
- Potential drug targets
- Enzymes
- ENZYME proteins:Hydrolases
- Disease related genes
Ensembl
Entrez Gene Symbol
Gene Synonym
KIAA0581PLC-IPLC154
Gene Description
Phospholipase C beta 1
Chromosome
20
Position
8077251-8968360
Frequency
4
EVMP Score
0.50
Fluorescence & Localization
Tissue Specificblood vesselCell SpecificPeritubular myoid cellsSingle-Nuclei Brain Specificvascular associated smooth muscle cell
Function & Pathway
Protein Function
- Predicted intracellular proteins
- Human disease related genes:Nervous system diseases:Epilepsy
- Potential drug targets
- Enzymes
- ENZYME proteins:Hydrolases
- Disease related genes
Cellular Component
Molecular Function
- GO:0004435 phosphatidylinositol phospholipase C activity
- GO:0004629 phospholipase C activity
- GO:0005096 GTPase activator activity
- GO:0005509 calcium ion binding
- GO:0005515 protein binding
- GO:0005516 calmodulin binding
- GO:0005521 lamin binding
- GO:0005546 phosphatidylinositol-4,5-bisphosphate binding
- GO:0019899 enzyme binding
- GO:0042802 identical protein binding
Biological Process
KEGG
- hsa00562 Inositol phosphate metabolism
- KEGG:hsa01100 Metabolic pathways
- KEGG:hsa04015 Rap1 signaling pathway
- KEGG:hsa04020 Calcium signaling pathway
- KEGG:hsa04022 cGMP-PKG signaling pathway
- KEGG:hsa04062 Chemokine signaling pathway
- KEGG:hsa04070 Phosphatidylinositol signaling system
- KEGG:hsa04071 Sphingolipid signaling pathway
- KEGG:hsa04072 Phospholipase D signaling pathway
- KEGG:hsa04081 Hormone signaling
- KEGG:hsa04082 Neuroactive ligand signaling
- KEGG:hsa04261 Adrenergic signaling in cardiomyocytes
- KEGG:hsa04270 Vascular smooth muscle contraction
- KEGG:hsa04310 Wnt signaling pathway
- KEGG:hsa04371 Apelin signaling pathway
- KEGG:hsa04540 Gap junction
- KEGG:hsa04611 Platelet activation
- KEGG:hsa04613 Neutrophil extracellular trap formation
- KEGG:hsa04621 NOD-like receptor signaling pathway
- KEGG:hsa04713 Circadian entrainment
- KEGG:hsa04720 Long-term potentiation
- KEGG:hsa04723 Retrograde endocannabinoid signaling
- KEGG:hsa04724 Glutamatergic synapse
- KEGG:hsa04725 Cholinergic synapse
- KEGG:hsa04726 Serotonergic synapse
- KEGG:hsa04728 Dopaminergic synapse
- KEGG:hsa04730 Long-term depression
- KEGG:hsa04742 Taste transduction
- KEGG:hsa04750 Inflammatory mediator regulation of TRP channels
- KEGG:hsa04911 Insulin secretion
- KEGG:hsa04912 GnRH signaling pathway
- KEGG:hsa04915 Estrogen signaling pathway
- KEGG:hsa04916 Melanogenesis
- KEGG:hsa04918 Thyroid hormone synthesis
- KEGG:hsa04919 Thyroid hormone signaling pathway
- KEGG:hsa04921 Oxytocin signaling pathway
- KEGG:hsa04922 Glucagon signaling pathway
- KEGG:hsa04924 Renin secretion
- KEGG:hsa04925 Aldosterone synthesis and secretion
- KEGG:hsa04926 Relaxin signaling pathway
- KEGG:hsa04927 Cortisol synthesis and secretion
- KEGG:hsa04928 Parathyroid hormone synthesis, secretion and action
- KEGG:hsa04929 GnRH secretion
- KEGG:hsa04933 AGE-RAGE signaling pathway in diabetic complications
- KEGG:hsa04934 Cushing syndrome
- KEGG:hsa04935 Growth hormone synthesis, secretion and action
- KEGG:hsa04961 Endocrine and other factor-regulated calcium reabsorption
- KEGG:hsa04970 Salivary secretion
- KEGG:hsa04971 Gastric acid secretion
- KEGG:hsa04972 Pancreatic secretion
- KEGG:hsa04973 Carbohydrate digestion and absorption
- KEGG:hsa05010 Alzheimer disease
- KEGG:hsa05016 Huntington disease
- KEGG:hsa05017 Spinocerebellar ataxia
- KEGG:hsa05022 Pathways of neurodegeneration - multiple diseases
- KEGG:hsa05131 Shigellosis
- KEGG:hsa05142 Chagas disease
- KEGG:hsa05143 African trypanosomiasis
- KEGG:hsa05146 Amoebiasis
- KEGG:hsa05163 Human cytomegalovirus infection
- KEGG:hsa05200 Pathways in cancer
- KEGG:hsa05415 Diabetic cardiomyopathy
- KEGG:hsa05417 Lipid and atherosclerosis
Reactome
- R-hsa-399997 acetylcholine regulates insulin secretion
- R-hsa-451326 activation of kainate receptors upon glutamate binding
- R-hsa-3858494 beta catenin independent wnt signaling
- R-hsa-4086398 ca2 pathway
- R-hsa-434316 fatty acids bound to gpr40 ffar1 regulate insulin secretion
- R-hsa-400451 free fatty acids regulate insulin secretion
- R-hsa-418594 g alpha i signalling events
- R-hsa-416476 g alpha q signalling events
- R-hsa-397795 g protein beta gamma signalling
- R-hsa-112040 g protein mediated events
- R-hsa-1483249 inositol phosphate metabolism
- R-hsa-163685 integration of energy metabolism
- R-hsa-112316 neuronal system
- R-hsa-112314 neurotransmitter receptors and postsynaptic signal transmission
- R-hsa-111885 opioid signalling
- R-hsa-500657 presynaptic function of kainate receptors
- R-hsa-422356 regulation of insulin secretion
- R-hsa-372790 signaling by gpcr
- R-hsa-195721 signaling by wnt
- R-hsa-1855204 synthesis of ip3 and ip4 in the cytosol
- R-hsa-112315 transmission across chemical synapses
Canonical Pathways
- M118 Pid integrin a9b1 pathway
- M99 Pid txa2pathway
- M18 Pid integrin1 pathway
Mediation Categories
Fusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
11 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| PLCB1 | MAPK3 | P27361 | S | 982 | phosphorylation | PhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:11287604ProtMapper:11287604phosphoELM:11287604KEA:11287604HPRD:11287604 |
| PLCB1 | PRKCA | P17252 | S | 887 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapperREACH_ProtMapper | HPRD:11278470ProtMapper:21338571SIGNOR:11278470KEA:11278470KEA:17570479ProtMapper:11278470KEA:9349568 |
| PLCB1 | MAPK1 | P28482 | S | 982 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:11287604ProtMapper:11287604 |
| PLCB1 | PRKCD | Q05655 | S | 887 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPHPRDKEA | KEA:11278470HPRD:11278470 |
| PLCB1 | PRKCB | P05771 | S | 887 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP | |
| PLCB1 | PRKCG | P05129 | S | 887 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP | |
| PLCB1 | PRKCE | Q02156 | S | 887 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP | |
| PLCB1 | CDK2 | P24941 | S | 982 | phosphorylation | KEA | KEA:17570479 |
| PLCB1 | GSK3B | P49841 | S | 982 | phosphorylation | KEA | KEA:17570479 |
| PLCB1 | MAP2K1 | Q02750 | S | 982 | phosphorylation | KEA | KEA:11287604 |
Page 1 of 2Next
Ligand-Receptor Signaling
7 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | No | Yes | No | No | No |
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| receptor | receptor | scConnect | No | Yes | No | No | No |
Regulatory Interaction Network
16 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| MK03 | P27361 | PLCB1 | Q9NQ66 | Yes | Yes | No | HPRD_MIMPSIGNORProtMapperPhosphoSite_KEAphosphoELM_KEAPhosphoNetworksHPRDPhosphoSite_ProtMapperHPRD-phosphosphoELM_MIMPPhosphoSite_MIMPMIMPPhosphoSite_norefPhosphoPointiPTMnetKEAHPRD_KEAphosphoELMSIGNOR_ProtMapperSPIKE_LCSPIKE | SIGNOR:11287604ProtMapper:11287604HPRD-phos:11287604SPIKE:11481231phosphoELM:11287604SPIKE_LC:11481231KEA:11287604HPRD:11287604 |
| MK01 | P28482 | PLCB1 | Q9NQ66 | Yes | Yes | No | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDSIGNOR_ProtMapperSPIKEPhosphoSite_ProtMapperSPIKE_LC | SIGNOR:11287604ProtMapper:11287604HPRD:11481231SPIKE:11481231SPIKE_LC:11481231 |
| GNAQ | P50148 | PLCB1 | Q9NQ66 | Yes | Yes | No | KEGG-MEDICUSSIGNORHPRDCui2007HINTBioGRIDCA1WangLit-BM-17 | HINT:11753430HPRD:11753430CA1:1322796CA1:1846707Lit-BM-17:11753430SIGNOR:8245028Lit-BM-17:16754659CA1:8387502CA1:1309799HINT:16754659BioGRID:11753430HPRD:12193606 |
| GNA11 | P29992 | PLCB1 | Q9NQ66 | Yes | Yes | No | KEGG-MEDICUSSIGNORCui2007CA1Wang | CA1:12578375SIGNOR:27515033 |
| PLCB1 | Q9NQ66 | GNA11 | P29992 | Yes | Yes | No | WangSIGNOR | SIGNOR:1322796 |
| KPCA | P17252 | PLCB1 | Q9NQ66 | Yes | No | Yes | HPRD_MIMPSIGNORProtMapperPhosphoSite_KEAHPRDCui2007Kinexus_KEACA1WangNetworKIN_KEAphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetPhosphoPointKEAHPRD_KEASIGNOR_ProtMapperREACH_ProtMapperHPRD-phos | CA1:9015864HPRD-phos:11278470HPRD:11278470CA1:2211670ProtMapper:21338571SIGNOR:11278470CA1:9307019KEA:11278470KEA:17570479ProtMapper:11278470KEA:9349568 |
| DVL1 | O14640 | PLCB1 | Q9NQ66 | Yes | Yes | No | SIGNOR | SIGNOR:19279717 |
| GNA14 | O95837 | PLCB1 | Q9NQ66 | Yes | Yes | No | KEGG-MEDICUSWangSIGNOR | SIGNOR:1334487 |
| GNA15 | P30679 | PLCB1 | Q9NQ66 | Yes | Yes | No | KEGG-MEDICUSWangCui2007SIGNOR | SIGNOR:1334487 |
| GBB1 | P62873 | PLCB1 | Q9NQ66 | Yes | Yes | Yes | WangSIGNOR | SIGNOR:8870665 |
Page 1 of 2Next
Protein Complex Composition
Sequence, Structure & Domains
Sequences
Length
1,216
Mass
138,567
Sequence
MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWDDDSTIVTPIILRTDPQGFFFYWTDQNKETELLDLSLVKDARCGRHAKAPKDPKLRELLDVGNIGRLEQRMITVVYGPDLVNISHLNLVAFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSADRKRVETALEACSLPSSRNDSIPQEDFTPEVYRVFLNNLCPRPEIDNIFSEFGAKSKPYLTVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPNNSLARKGQISVDGFMRYLSGEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCVELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQQAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEGSGKKKLSEQASNTYSDSSSMFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEMSNLVNYIQPVKFESFEISKKRNKSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPKGTRVDSSNYMPQLFWNAGCQMVALNFQTMDLAMQINMGMYEYNGKSGYRLKPEFMRRPDKHFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQGNAVNPVWEEEPIVFKKVVLPTLACLRIAVYEEGGKFIGHRILPVQAIRPGYHYICLRNERNQPLTLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKKEADPGETPSEAPSEARTTPAENGVNHTTTLTPKPPSQALHSQPAPGSVKAPAKTEDLIQSVLTEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNEIQNDYLRRRAALEKSAKKDSKKKSEPSSPDHGSSTIEQDLAALDAEMTQKLIDLKDKQQQQLLNLRQEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEICEKEKKELKKKMDKKRQEKITEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKPKLQVELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHGSAPLSLSSDPGKVNHKTPSSEELGGDIPGKEFDTPL
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=A; IsoId=Q9NQ66-1; Sequence=Displayed; Name=B; IsoId=Q9NQ66-2; Sequence=VSP_004718
Alternative Sequence
1142..1216; LQVELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHGSAPLSLSSDPGKVNHKTPSSEELGGDIPGKEFDTPL -> GEGSSSFLSETCHEDPSVSPNFTPPNPQALKW (in isoform B)
3D Structural Models
Domain & Motif Annotations
Compositional Bias
472..483; Basic and acidic residues; 491..501; Low complexity; 507..518; Acidic residues; 855..871; Polar residues; 963..979; Basic and acidic residues; 1075..1095; Basic and acidic residues
Domain (FT)
316..467; PI-PLC X-box; 540..656; PI-PLC Y-box; 656..786; C2
Region
469..534; Disordered; 834..891; Disordered; 963..994; Disordered; 1071..1095; Disordered; 1173..1216; Disordered
Clinical Relevance
Disease Involvement
Epilepsy