Protein detail
PLCB1
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 (EC 3.1.4.11) (PLC-154) (Phosphoinositide phospholipase C-beta-1) (Phospholipase C-I) (PLC-I) (Phospholipase C-beta-1) (PLC-beta-1)
Entry name PLCB1 | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 4 | Transmembrane count | Protein classification Disease related genesEnzymesHuman disease related genesMetabolic proteinsPlasma proteinsPotential drug targetsPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 (EC 3.1.4.11) (PLC-154) (Phosphoinositide phospholipase C-beta-1) (Phospholipase C-I) (PLC-I) (Phospholipase C-beta-1) (PLC-beta-1)
Protein Class (7)
Disease related genesEnzymesHuman disease related genesMetabolic proteinsPlasma proteinsPotential drug targetsPredicted intracellular proteins
Protein Function (6)
- Predicted intracellular proteins
- Human disease related genes:Nervous system diseases:Epilepsy
- Potential drug targets
- Enzymes
- ENZYME proteins:Hydrolases
- Disease related genes
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
KIAA0581PLC-IPLC154
Gene Description
Phospholipase C beta 1
Chromosome
20
Position
8077251-8968360
Supporting publications (n)
4
EVMP confidence score
0.40
Fluorescence & Localization
Tissue Specificblood vesselCell SpecificPeritubular myoid cellsSingle-Nuclei Brain Specificvascular associated smooth muscle cell
Function & Pathway
Protein Function (6)
- Predicted intracellular proteins
- Human disease related genes:Nervous system diseases:Epilepsy
- Potential drug targets
- Enzymes
- ENZYME proteins:Hydrolases
- Disease related genes
Cellular Component (11)
- GO:0000785 chromatin
- GO:0005634 nucleus
- GO:0005737 cytoplasm
- GO:0005829 cytosol
- GO:0016607 nuclear speck
- GO:0031965 nuclear membrane
- GO:0032991 protein-containing complex
- GO:0070062 extracellular exosome
- GO:0098978 glutamatergic synapse
- GO:0098982 GABA-ergic synapse
Page 1 of 2
Molecular Function (10)
- GO:0004435 phosphatidylinositol phospholipase C activity
- GO:0004629 phospholipase C activity
- GO:0005096 GTPase activator activity
- GO:0005509 calcium ion binding
- GO:0005515 protein binding
- GO:0005516 calmodulin binding
- GO:0005521 lamin binding
- GO:0005546 phosphatidylinositol-4,5-bisphosphate binding
- GO:0019899 enzyme binding
- GO:0042802 identical protein binding
Biological Process (3)
KEGG (63)
- hsa00562 Inositol phosphate metabolism
- KEGG:hsa01100 Metabolic pathways
- KEGG:hsa04015 Rap1 signaling pathway
- KEGG:hsa04020 Calcium signaling pathway
- KEGG:hsa04022 cGMP-PKG signaling pathway
- KEGG:hsa04062 Chemokine signaling pathway
- KEGG:hsa04070 Phosphatidylinositol signaling system
- KEGG:hsa04071 Sphingolipid signaling pathway
- KEGG:hsa04072 Phospholipase D signaling pathway
- KEGG:hsa04081 Hormone signaling
Page 1 of 7
Reactome (21)
- R-hsa-399997 acetylcholine regulates insulin secretion
- R-hsa-451326 activation of kainate receptors upon glutamate binding
- R-hsa-3858494 beta catenin independent wnt signaling
- R-hsa-4086398 ca2 pathway
- R-hsa-434316 fatty acids bound to gpr40 ffar1 regulate insulin secretion
- R-hsa-400451 free fatty acids regulate insulin secretion
- R-hsa-418594 g alpha i signalling events
- R-hsa-416476 g alpha q signalling events
- R-hsa-397795 g protein beta gamma signalling
- R-hsa-112040 g protein mediated events
Page 1 of 3
Canonical Pathways (3)
- M118 Pid integrin a9b1 pathway
- M99 Pid txa2pathway
- M18 Pid integrin1 pathway
Mediation Categories (4)
Fusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence36
Enzyme-Mediated Modification (11)
11 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| PLCB1 | MAPK14 | Q16539 | S | 982 | phosphorylation | KEA | KEA:17570479 |
Page 2 of 2Previous
Ligand-Receptor Signaling (7)
7 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | Yes | ||||
| intracellular | intracellular | LOCATE | |||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath | |||||
| receptor | receptor | scConnect | Yes |
Regulatory Interaction Network (16)
16 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| DVL2 | O14641 | PLCB1 | Q9NQ66 | Yes | Yes | SIGNOR | SIGNOR:19279717 | |
| GNAS3 | O95467 | PLCB1 | Q9NQ66 | Yes | Yes | SIGNOR | SIGNOR:8245028 | |
| ALEX | P84996 | PLCB1 | Q9NQ66 | Yes | Yes | SIGNOR | SIGNOR:8245028 | |
| GNAS2 | P63092 | PLCB1 | Q9NQ66 | Yes | Yes | SIGNOR | SIGNOR:8245028 | |
| GNAS1 | Q5JWF2 | PLCB1 | Q9NQ66 | Yes | Yes | SIGNOR | SIGNOR:8245028 | |
| DVL3 | Q92997 | PLCB1 | Q9NQ66 | Yes | Yes | SIGNOR | SIGNOR:19279717 |
Page 2 of 2Previous
Protein Complex Composition (1)
Sequence, Structure & Domains
Sequences
Length
1,216
Mass
138,567
Sequence
MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWDDDSTIVTPIILRTDPQGFFFYWTDQNKETELLDLSLVKDARCGRHAKAPKDPKLRELLDVGNIGRLEQRMITVVYGPDLVNISHLNLVAFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSADRKRVETALEACSLPSSRNDSIPQEDFTPEVYRVFLNNLCPRPEIDNIFSEFGAKSKPYLTVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPNNSLARKGQISVDGFMRYLSGEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCVELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQQAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEGSGKKKLSEQASNTYSDSSSMFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEMSNLVNYIQPVKFESFEISKKRNKSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPKGTRVDSSNYMPQLFWNAGCQMVALNFQTMDLAMQINMGMYEYNGKSGYRLKPEFMRRPDKHFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQGNAVNPVWEEEPIVFKKVVLPTLACLRIAVYEEGGKFIGHRILPVQAIRPGYHYICLRNERNQPLTLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKKEADPGETPSEAPSEARTTPAENGVNHTTTLTPKPPSQALHSQPAPGSVKAPAKTEDLIQSVLTEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNEIQNDYLRRRAALEKSAKKDSKKKSEPSSPDHGSSTIEQDLAALDAEMTQKLIDLKDKQQQQLLNLRQEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEICEKEKKELKKKMDKKRQEKITEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKPKLQVELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHGSAPLSLSSDPGKVNHKTPSSEELGGDIPGKEFDTPL
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=A; IsoId=Q9NQ66-1; Sequence=Displayed; Name=B; IsoId=Q9NQ66-2; Sequence=VSP_004718
Alternative Sequence
1142..1216; LQVELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHGSAPLSLSSDPGKVNHKTPSSEELGGDIPGKEFDTPL -> GEGSSSFLSETCHEDPSVSPNFTPPNPQALKW (in isoform B)
Domain & Motif Annotations
Compositional Bias
472..483; Basic and acidic residues; 491..501; Low complexity; 507..518; Acidic residues; 855..871; Polar residues; 963..979; Basic and acidic residues; 1075..1095; Basic and acidic residues
Domain (FT)
316..467; PI-PLC X-box; 540..656; PI-PLC Y-box; 656..786; C2
Region
469..534; Disordered; 834..891; Disordered; 963..994; Disordered; 1071..1095; Disordered; 1173..1216; Disordered
Clinical Relevance
Supporting Publications4
| PMID | Title | Related sentences |
|---|---|---|
| 31759091 | Identification of actin network proteins, talin-1 and filamin-A, in circulating extracellular vesicles as blood biomarkers for human myalgic encephalomyelitis/chronic fatigue syndrome. | No related sentences available |
| 37686366 | Identification of a Non-Invasive Urinary Exosomal Biomarker for Diabetic Nephropathy Using Data-Independent Acquisition Proteomics. | No related sentences available |
| 38225453 | Deep proteomic analysis of obstetric antiphospholipid syndrome by DIA-MS of extracellular vesicle enriched fractions. | No related sentences available |
| 38731868 | The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer. | No related sentences available |