Protein detail
AVEN
Cell death regulator Aven
Entry name AVEN | UniProt ID | EVMP confidence score 0.63 |
Supporting publications (n) 8 | Transmembrane count | Protein classification Predicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Cell death regulator Aven
Protein Class
Predicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
PDCD12
Gene Description
Apoptosis and caspase activation inhibitor
Chromosome
15
Position
33858782-34075155
Supporting publications (n)
8
EVMP confidence score
0.63
Fluorescence & Localization5
Tissue SpecificplacentaCell SpecificKupffer cellsSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell Specificnon-classical monocyte
Function & Pathway6
Protein Function
Predicted intracellular proteins
Cellular Component (3)
Molecular Function
Biological Process (3)
Reactome (6)
Mediation Categories
Other mediation
Relations & Evidence9
Enzyme-Mediated Modification (2)
2 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| AVEN | ATM | Q13315 | S | 135 | phosphorylation | PhosphoSite_MIMPMIMPSIGNORProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:18571408 |
| AVEN | ATM | Q13315 | S | 308 | phosphorylation | PhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:18571408 |
Ligand-Receptor Signaling (4)
4 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Regulatory Interaction Network (2)
2 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| ATM | Q13315 | AVEN | Q9NQS1 | Yes | Yes | No | PhosphoSite_MIMPMIMPHPRD_MIMPPhosphoSite_norefSIGNORiPTMnetProtMapperSIGNOR_ProtMapperSPIKEPhosphoSite_ProtMapperSPIKE_LC | SPIKE_LC:18571408SIGNOR:18571408ProtMapper:18571408SPIKE:18571408 |
| AVEN | Q9NQS1 | ATM | Q13315 | Yes | Yes | No | SPIKESPIKE_LCSIGNOR | SPIKE_LC:18571408SIGNOR:18571408SPIKE:18571408 |
Sequence, Structure & Domains5
Sequences
Length
362
Mass
38,506
Sequence
MQAERGARGGRGRRPGRGRPGGDRHSERPGAAAAVARGGGGGGGGDGGGRRGRGRGRGFRGARGGRGGGGAPRGSRREPGGWGAGASAPVEDDSDAETYGEENDEQGNYSKRKIVSNWDRYQDIEKEVNNESGESQRGTDFSVLLSSAGDSFSQFRFAEEKEWDSEASCPKQNSAFYVDSELLVRALQELPLCLRLNVAAELVQGTVPLEVPQVKPKRTDDGKGLGMQLKGPLGPGGRGPIFELKSVAAGCPVLLGKDNPSPGPSRDSQKPTSPLQSAGDHLEEELDLLLNLDAPIKEGDNILPDQTSQDLKSKEDGEVVQEEEVCAKPSVTEEKNMEPEQPSTSKNVTEEELEDWLDSMIS
Domain & Motif Annotations
Compositional Bias
8..17; Basic residues; 37..47; Gly residues; 50..60; Basic residues; 61..72; Gly residues; 90..105; Acidic residues; 350..362; Acidic residues
Region
1..111; Disordered; 214..237; Disordered; 253..362; Disordered
Clinical Relevance1
Antibody
Supporting Publications8
| PMID | Title | Abstract |
|---|---|---|
| 27821849 | Detailed Analysis of Protein Topology of Extracellular Vesicles-Evidence of Unconventional Membrane Protein Orientation. | No abstract available |
| 32854315 | Proteomic Profiling of Extracellular Vesicles Derived from Cerebrospinal Fluid of Alzheimer's Disease Patients: A Pilot Study. | Recent studies have highlighted the importance of Aβ and tau-containing extracellular vesicles (EVs) in AD. |
| 37322475 | Comprehensive profiling of extracellular vesicles in uveitis and scleritis enables biomarker discovery and mechanism exploration. | No abstract available |
| 38113368 | In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum. | No abstract available |
| 38207106 | Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity. | No abstract available |
| 40189497 | Small extracellular vesicle-based one-step high-throughput microfluidic platform for epithelial ovarian cancer diagnosis. | No abstract available |
| 41068253 | Identification of plasma extracellular vesicle protein biomarkers in diabetic retinopathy progression. | No abstract available |
| 41307968 | Extracellular Vesicles Define Discrete Nano-Based Niches Within the Human Haematopoietic System. | No abstract available |