Protein detail
GTR9
Solute carrier family 2, facilitated glucose transporter member 9 (Glucose transporter type 9) (GLUT-9) (Urate transporter)
Entry name GTR9 | UniProt ID | EVMP confidence score 0.25 |
Supporting publications (n) 2 | Transmembrane count 12 | Protein classification Disease related genesHuman disease related genesMetabolic proteinsPotential drug targetsPredicted membrane proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Solute carrier family 2, facilitated glucose transporter member 9 (Glucose transporter type 9) (GLUT-9) (Urate transporter)
Protein Class (6)
Disease related genesHuman disease related genesMetabolic proteinsPotential drug targetsPredicted membrane proteinsTransporters
Protein Function (5)
- Human disease related genes:Urinary system diseases:Kidney diseases
- Potential drug targets
- Transporters:Electrochemical Potential-driven transporters
- Disease related genes
- Human disease related genes:Musculoskeletal diseases:Other musculoskeletal diseases
Transmembrane
52..72; Helical; Name=1; 108..128; Helical; Name=2; 141..161; Helical; Name=3; 172..192; Helical; Name=4; 201..221; Helical; Name=5; 232..252; Helical; Name=6; 317..337; Helical; Name=7; 355..375; Helical; Name=8; 382..402; Helical; Name=9; 416..436; Helical; Name=10; 452..472; Helical; Name=11; 479..499; Helical; Name=12
Transmembrane Count
12
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
Glut9GLUTXURATv1
Gene Description
Solute carrier family 2 member 9
Chromosome
4
Position
9771153-10054936
Supporting publications (n)
2
EVMP confidence score
0.25
Fluorescence & Localization4
Tissue SpecificretinaCell SpecificCone photoreceptor cellsBlood Cell SpecificneutrophilBlood Lineage Specificgranulocytes
Function & Pathway7
Protein Function (5)
- Human disease related genes:Urinary system diseases:Kidney diseases
- Potential drug targets
- Transporters:Electrochemical Potential-driven transporters
- Disease related genes
- Human disease related genes:Musculoskeletal diseases:Other musculoskeletal diseases
Cellular Component (4)
Molecular Function (7)
- GO:0005351 carbohydrate:proton symporter activity
- GO:0005353 fructose transmembrane transporter activity
- GO:0005515 protein binding
- GO:0015143 urate transmembrane transporter activity
- GO:0015149 hexose transmembrane transporter activity
- GO:0022857 transmembrane transporter activity
- GO:0055056 D-glucose transmembrane transporter activity
Biological Process (3)
Reactome (5)
Canonical Pathways
M264 Pid toll endogenous pathway
Mediation Categories (2)
Clinical-translation mediationFusion and delivery mediation
Relations & Evidence23
Ligand-Receptor Signaling (22)
22 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | TopDB | No | No | No | No | No |
| transmembrane | transmembrane | LOCATE | No | No | No | No | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | No | No |
| transmembrane | transmembrane | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| basolateral_cell_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| apical_cell_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
| cell_surface | cell_surface | Surfaceome | No | No | No | No | No |
| cell_surface | cell_surface | OmniPath | No | No | No | No | No |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion ChromatographyImmunoaffinity Capture | Western blotting | 1 | 40098346 |
Sequence, Structure & Domains9
Sequences
Length
540
Mass
58,702
Sequence
MARKQNRNSKELGLVPLTDDTSHAGPPGPGRALLECDHLRSGVPGGRRRKDWSCSLLVASLAGAFGSSFLYGYNLSVVNAPTPYIKAFYNESWERRHGRPIDPDTLTLLWSVTVSIFAIGGLVGTLIVKMIGKVLGRKHTLLANNGFAISAALLMACSLQAGAFEMLIVGRFIMGIDGGVALSVLPMYLSEISPKEIRGSLGQVTAIFICIGVFTGQLLGLPELLGKESTWPYLFGVIVVPAVVQLLSLPFLPDSPRYLLLEKHNEARAVKAFQTFLGKADVSQEVEEVLAESRVQRSIRLVSVLELLRAPYVRWQVVTVIVTMACYQLCGLNAIWFYTNSIFGKAGIPPAKIPYVTLSTGGIETLAAVFSGLVIEHLGRRPLLIGGFGLMGLFFGTLTITLTLQDHAPWVPYLSIVGILAIIASFCSGPGGIPFILTGEFFQQSQRPAAFIIAGTVNWLSNFAVGLLFPFIQKSLDTYCFLVFATICITGAIYLYFVLPETKNRTYAEISQAFSKRNKAYPPEEKIDSAVTDGKINGRP
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; Synonyms=SLC2A9-L, SLC2A9a; IsoId=Q9NRM0-1; Sequence=Displayed; Name=2; Synonyms=GLUT9deltaN, SLC2A9-S, SLC2A9b; IsoId=Q9NRM0-2; Sequence=VSP_034860
Alternative Sequence
1..50; MARKQNRNSKELGLVPLTDDTSHAGPPGPGRALLECDHLRSGVPGGRRRK -> MKLSKKDRGEDEESDSAKKKL (in isoform 2)
3D Structural Models
3D Structure
Electron microscopy (4)
Domain & Motif Annotations
Region
1..31; Disordered; 519..540; Disordered
Protein Families (3)
- Major facilitator superfamily
- Sugar transporter (TC 2.A.1.1) family
- Glucose transporter subfamily
Sequence Similarities
Belongs to the major facilitator superfamily. Sugar transporter (TC 2.A.1.1) family. Glucose transporter subfamily.
Supporting Publications2
| PMID | Title | Abstract |
|---|---|---|
| 32301581 | Proteomic and biological profiling of extracellular vesicles from Alzheimer's disease human brain tissues. | Extracellular vesicles (EVs) from human Alzheimer's disease (AD) biospecimens contain amyloid beta (Aβ) peptide and tau. |
| 38071653 | Extracellular vesicle proteome unveils cathepsin B connection to Alzheimer's disease pathogenesis. | No abstract available |