Protein detail
DIAP3
Protein diaphanous homolog 3 (Diaphanous-related formin-3) (DRF3) (MDia2)
Entry name DIAP3 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 4 | Transmembrane count | Protein classification |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Protein diaphanous homolog 3 (Diaphanous-related formin-3) (DRF3) (MDia2)
Protein Function (4)
- Disease related genes
- Cancer-related genes:Candidate cancer biomarkers
- Predicted intracellular proteins
- Human disease related genes:Nervous system diseases:Ear disease
Ensembl
Entrez Gene Symbol
Supporting publications (n)
4
EVMP confidence score
0.53
Fluorescence & Localization
Tissue Specificblood vesselCell SpecificAstrocytes
Function & Pathway
Protein Function (4)
- Disease related genes
- Cancer-related genes:Candidate cancer biomarkers
- Predicted intracellular proteins
- Human disease related genes:Nervous system diseases:Ear disease
Cellular Component (12)
- GO:0000813 ESCRT I complex
- GO:0000922 spindle pole
- GO:0005634 nucleus
- GO:0005737 cytoplasm
- GO:0005815 microtubule organizing center
- GO:0005829 cytosol
- GO:0005884 actin filament
- GO:0031941 filamentous actin
- GO:0032154 cleavage furrow
- GO:0032432 actin filament bundle
Page 1 of 2
Molecular Function (5)
Biological Process (3)
Reactome (16)
- R-hsa-9013148 cdc42 gtpase cycle
- R-hsa-9013149 rac1 gtpase cycle
- R-hsa-9013404 rac2 gtpase cycle
- R-hsa-9013423 rac3 gtpase cycle
- R-hsa-8980692 rhoa gtpase cycle
- R-hsa-9013026 rhob gtpase cycle
- R-hsa-9013106 rhoc gtpase cycle
- R-hsa-9013405 rhod gtpase cycle
- R-hsa-9035034 rhof gtpase cycle
- R-hsa-9013408 rhog gtpase cycle
Page 1 of 2
Mediation Categories (3)
Fusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence6
Enzyme-Mediated Modification (1)
1 record.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| DIAPH3 | CDK2 | P24941 | T | 19 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper |
Ligand-Receptor Signaling (4)
4 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath |
Sequence, Structure & Domains
Sequences
Length
1,193
Mass
136,926
Sequence
MERHQPRLHHPAQGSAAGTPYPSSASLRGCRESKMPRRKGPQHPPPPSGPEEPGEKRPKFHLNIRTLTDDMLDKFASIRIPGSKKERPPLPNLKTAFASSDCSAAPLEMMENFPKPLSENELLELFEKMMEDMNLNEDKKAPLREKDFSIKKEMVMQYINTASKTGSLKRSRQISPQEFIHELKMGSADERLVTCLESLRVSLTSNPVSWVESFGHEGLGLLLDILEKLISGKIQEKVVKKNQHKVIQCLKALMNTQYGLERIMSEERSLSLLAKAVDPRHPNMMTDVVKLLSAVCIVGEESILEEVLEALTSAGEEKKIDRFFCIVEGLRHNSVQLQVACMQLINALVTSPDDLDFRLHIRNEFMRCGLKEILPNLKCIKNDGLDIQLKVFDEHKEEDLFELSHRLEDIRAELDEAYDVYNMVWSTVKETRAEGYFISILQHLLLIRNDYFIRQQYFKLIDECVSQIVLHRDGMDPDFTYRKRLDLDLTQFVDICIDQAKLEEFEEKASELYKKFEKEFTDHQETQAELQKKEAKINELQAELQAFKSQFGALPADCNIPLPPSKEGGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLPGMRMPFSGPVPPPPPLGFLGGQNSPPLPILPFGLKPKKEFKPEISMRRLNWLKIRPHEMTENCFWIKVNENKYENVDLLCKLENTFCCQQKERREEEDIEEKKSIKKKIKELKFLDSKIAQNLSIFLSSFRVPYEEIRMMILEVDETRLAESMIQNLIKHLPDQEQLNSLSQFKSEYSNLCEPEQFVVVMSNVKRLRPRLSAILFKLQFEEQVNNIKPDIMAVSTACEEIKKSKSFSKLLELVLLMGNYMNAGSRNAQTFGFNLSSLCKLKDTKSADQKTTLLHFLVEICEEKYPDILNFVDDLEPLDKASKVSVETLEKNLRQMGRQLQQLEKELETFPPPEDLHDKFVTKMSRFVISAKEQYETLSKLHENMEKLYQSIIGYYAIDVKKVSVEDFLTDLNNFRTTFMQAIKENIKKREAEEKEKRVRIAKELAERERLERQQKKKRLLEMKTEGDETGVMDNLLEALQSGAAFRDRRKRTPMPKDVRQSLSPMSQRPVLKVCNHENQKVQLTEGSRSHYNINCNSTRTPVAKELNYNLDTHTSTGRIKAAEKKEACNVESNRKKETELLGSFSKNESVPEVEALLARLRAL
Alternative Products
Event=Alternative splicing; Named isoforms=7; Name=3; IsoId=Q9NSV4-3; Sequence=Displayed; Name=1; IsoId=Q9NSV4-1; Sequence=VSP_015958, VSP_027777, VSP_027778; Name=2; IsoId=Q9NSV4-2; Sequence=VSP_015958, VSP_001574, VSP_001575; Name=4; IsoId=Q9NSV4-4; Sequence=VSP_027774; Name=5; IsoId=Q9NSV4-5; Sequence=VSP_027774, VSP_027776; Name=6; IsoId=Q9NSV4-6; Sequence=VSP_027774, VSP_027775; Name=7; IsoId=Q9NSV4-7; Sequence=VSP_027777, VSP_027778
Alternative Sequence
1..263; Missing (in isoform 1 and isoform 2); 61..71; Missing (in isoform 4, isoform 5 and isoform 6); 72..130; Missing (in isoform 6); 131..165; Missing (in isoform 5); 913..956; VSVETLEKNLRQMGRQLQQLEKELETFPPPEDLHDKFVTKMSRF -> GLCLFKKHFMALIFSAKRLKIIPFICMYFPLSHSVFIPNISF (in isoform 2); 957..1193; Missing (in isoform 2); 1107..1112; ENQKVQ -> GNKPYL (in isoform 7 and isoform 1); 1113..1193; Missing (in isoform 7 and isoform 1)
3D Structural Models
Helix
1184..1191
3D Structure
X-ray crystallography (2)
Domain & Motif Annotations
Compositional Bias
1..10; Basic residues; 575..600; Pro residues
Motif
36..60; Nuclear localization signal; 1184..1193; Nuclear export signal
Coiled Coil
497..554; 1013..1056
Domain (CC)
The DAD domain regulates activation via by an autoinhibitory interaction with the GBD/FH3 domain. This autoinhibition is released upon competitive binding of an activated GTPase. The release of DAD allows the FH2 domain to then nucleate and elongate nonbranched actin filaments.
Domain (FT)
114..476; GBD/FH3; 561..631; FH1; 636..1034; FH2; 1057..1087; DAD
Region
1..57; Disordered; 558..622; Disordered
Protein Families (2)
- Formin homology family
- Diaphanous subfamily
Sequence Similarities
Belongs to the formin homology family. Diaphanous subfamily.
Clinical Relevance
Drugs
Supporting Publications4
| PMID | Title | Related sentences |
|---|---|---|
| 26775013 | Proteomic characterization of circulating extracellular vesicles identifies novel serum myeloma associated markers. | No related sentences available |
| 30805606 | Ionizing radiation affects the composition of the proteome of extracellular vesicles released by head-and-neck cancer cells in vitro. | No related sentences available |
| 38731868 | The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer. | No related sentences available |
| 40098346 | Toward Identification of Markers for Brain-Derived Extracellular Vesicles in Cerebrospinal Fluid: A Large-Scale, Unbiased Analysis Using Proximity Extension Assays. | No related sentences available |