Protein detail

DIAP3

Protein diaphanous homolog 3 (Diaphanous-related formin-3) (DRF3) (MDia2)

Entry name DIAP3	UniProt ID Q9NSV4	EVMP confidence score 0.38
Supporting publications (n) 4	Transmembrane count	Protein classification

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information6

Protein Names

Protein diaphanous homolog 3 (Diaphanous-related formin-3) (DRF3) (MDia2)

Protein Function (4)

Disease related genes
Cancer-related genes:Candidate cancer biomarkers
Predicted intracellular proteins
Human disease related genes:Nervous system diseases:Ear disease

Ensembl

ENSG00000139734

Entrez Gene Symbol

DIAPH3

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization2

Tissue Specificblood vesselCell SpecificAstrocytes

Function & Pathway7

Protein Function (4)

Disease related genes
Cancer-related genes:Candidate cancer biomarkers
Predicted intracellular proteins
Human disease related genes:Nervous system diseases:Ear disease

Cellular Component (12)

Page 1 of 2

Molecular Function (5)

Biological Process (3)

KEGG (2)

Reactome (16)

Page 1 of 2

Mediation Categories (3)

Fusion and delivery mediationImmune mediationReceptor-signaling mediation

Relations & Evidence6

Enzyme-Mediated Modification (1)

1 record.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
DIAPH3	CDK2	P24941	T	19	phosphorylation	PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper

Ligand-Receptor Signaling (4)

4 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometrySmall R sequencing (Illumi HiSeq 2000 (Solexa)R Sequencing	4	35119778 36394150 31382537 38716512

Sequence, Structure & Domains15

Sequences

Length

1,193

Mass

136,926

Sequence

MERHQPRLHHPAQGSAAGTPYPSSASLRGCRESKMPRRKGPQHPPPPSGPEEPGEKRPKFHLNIRTLTDDMLDKFASIRIPGSKKERPPLPNLKTAFASSDCSAAPLEMMENFPKPLSENELLELFEKMMEDMNLNEDKKAPLREKDFSIKKEMVMQYINTASKTGSLKRSRQISPQEFIHELKMGSADERLVTCLESLRVSLTSNPVSWVESFGHEGLGLLLDILEKLISGKIQEKVVKKNQHKVIQCLKALMNTQYGLERIMSEERSLSLLAKAVDPRHPNMMTDVVKLLSAVCIVGEESILEEVLEALTSAGEEKKIDRFFCIVEGLRHNSVQLQVACMQLINALVTSPDDLDFRLHIRNEFMRCGLKEILPNLKCIKNDGLDIQLKVFDEHKEEDLFELSHRLEDIRAELDEAYDVYNMVWSTVKETRAEGYFISILQHLLLIRNDYFIRQQYFKLIDECVSQIVLHRDGMDPDFTYRKRLDLDLTQFVDICIDQAKLEEFEEKASELYKKFEKEFTDHQETQAELQKKEAKINELQAELQAFKSQFGALPADCNIPLPPSKEGGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLPGMRMPFSGPVPPPPPLGFLGGQNSPPLPILPFGLKPKKEFKPEISMRRLNWLKIRPHEMTENCFWIKVNENKYENVDLLCKLENTFCCQQKERREEEDIEEKKSIKKKIKELKFLDSKIAQNLSIFLSSFRVPYEEIRMMILEVDETRLAESMIQNLIKHLPDQEQLNSLSQFKSEYSNLCEPEQFVVVMSNVKRLRPRLSAILFKLQFEEQVNNIKPDIMAVSTACEEIKKSKSFSKLLELVLLMGNYMNAGSRNAQTFGFNLSSLCKLKDTKSADQKTTLLHFLVEICEEKYPDILNFVDDLEPLDKASKVSVETLEKNLRQMGRQLQQLEKELETFPPPEDLHDKFVTKMSRFVISAKEQYETLSKLHENMEKLYQSIIGYYAIDVKKVSVEDFLTDLNNFRTTFMQAIKENIKKREAEEKEKRVRIAKELAERERLERQQKKKRLLEMKTEGDETGVMDNLLEALQSGAAFRDRRKRTPMPKDVRQSLSPMSQRPVLKVCNHENQKVQLTEGSRSHYNINCNSTRTPVAKELNYNLDTHTSTGRIKAAEKKEACNVESNRKKETELLGSFSKNESVPEVEALLARLRAL

Alternative Products

Event=Alternative splicing; Named isoforms=7; Name=3; IsoId=Q9NSV4-3; Sequence=Displayed; Name=1; IsoId=Q9NSV4-1; Sequence=VSP_015958, VSP_027777, VSP_027778; Name=2; IsoId=Q9NSV4-2; Sequence=VSP_015958, VSP_001574, VSP_001575; Name=4; IsoId=Q9NSV4-4; Sequence=VSP_027774; Name=5; IsoId=Q9NSV4-5; Sequence=VSP_027774, VSP_027776; Name=6; IsoId=Q9NSV4-6; Sequence=VSP_027774, VSP_027775; Name=7; IsoId=Q9NSV4-7; Sequence=VSP_027777, VSP_027778

Alternative Sequence

1..263; Missing (in isoform 1 and isoform 2); 61..71; Missing (in isoform 4, isoform 5 and isoform 6); 72..130; Missing (in isoform 6); 131..165; Missing (in isoform 5); 913..956; VSVETLEKNLRQMGRQLQQLEKELETFPPPEDLHDKFVTKMSRF -> GLCLFKKHFMALIFSAKRLKIIPFICMYFPLSHSVFIPNISF (in isoform 2); 957..1193; Missing (in isoform 2); 1107..1112; ENQKVQ -> GNKPYL (in isoform 7 and isoform 1); 1113..1193; Missing (in isoform 7 and isoform 1)

3D Structural Models

Helix

1184..1191

3D Structure

X-ray crystallography (2)

Domain & Motif Annotations

Compositional Bias

1..10; Basic residues; 575..600; Pro residues

Motif

36..60; Nuclear localization signal; 1184..1193; Nuclear export signal

Coiled Coil

497..554; 1013..1056

Domain (CC)

The DAD domain regulates activation via by an autoinhibitory interaction with the GBD/FH3 domain. This autoinhibition is released upon competitive binding of an activated GTPase. The release of DAD allows the FH2 domain to then nucleate and elongate nonbranched actin filaments.

Domain (FT)

114..476; GBD/FH3; 561..631; FH1; 636..1034; FH2; 1057..1087; DAD

Region

1..57; Disordered; 558..622; Disordered

Protein Families (2)

Formin homology family
Diaphanous subfamily

Sequence Similarities

Belongs to the formin homology family. Diaphanous subfamily.

Clinical Relevance1

Drugs

HYDROCHLOROTHIAZIDE

Supporting Publications4

PMID	Title	Abstract
26775013	Proteomic characterization of circulating extracellular vesicles identifies novel serum myeloma associated markers.	No abstract available
30805606	Ionizing radiation affects the composition of the proteome of extracellular vesicles released by head-and-neck cancer cells in vitro.	No abstract available
38731868	The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer.	No abstract available
40098346	Toward Identification of Markers for Brain-Derived Extracellular Vesicles in Cerebrospinal Fluid: A Large-Scale, Unbiased Analysis Using Proximity Extension Assays.	No abstract available