Protein detail
EVA1B
Protein eva-1 homolog B (Protein FAM176B)
Entry name EVA1B | UniProt ID | EVMP confidence score 0.72 |
Supporting publications (n) 12 | Transmembrane count 1 | Protein classification Predicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Protein eva-1 homolog B (Protein FAM176B)
Protein Class
Predicted intracellular proteins
Protein Function
Predicted intracellular proteins
Transmembrane
29..49; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
C1orf78FAM176BFLJ10647
Gene Description
Eva-1 homolog B
Chromosome
1
Position
36322030-36324154
Supporting publications (n)
12
EVMP confidence score
0.72
Fluorescence & Localization1
Function & Pathway5
Protein Function
Predicted intracellular proteins
Cellular Component
Molecular Function
Biological Process (3)
Mediation Categories
Other mediation
Relations & Evidence13
Ligand-Receptor Signaling (12)
12 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane_sosui | transmembrane_predicted | Almen2009 | No | No | No | No | No |
| transmembrane_tmhmm | transmembrane_predicted | Almen2009 | No | No | No | No | No |
Page 2 of 2Previous
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 35289120 |
Sequence, Structure & Domains7
Sequences
Length
165
Mass
18,374
Sequence
MDAPRRDMELLSNSLAAYAHIRANPESFGLYFVLGVCFGLLLTLCLLVISISWAPRPRPRGPAQRRDPRSSTLEPEDDDEDEEDTVTRLGPDDTLPGPELSAEPDGPLNVNVFTSAEELERAQRLEERERILREIWRTGQPDLLGTGTLGPSPTATGTLGRMHYY
Domain & Motif Annotations
Compositional Bias
74..84; Acidic residues
Region
57..109; Disordered; 143..165; Disordered
Protein Families
EVA1 family
Sequence Similarities
Belongs to the EVA1 family.
Supporting Publications12
| PMID | Title | Abstract |
|---|---|---|
| 32854315 | Proteomic Profiling of Extracellular Vesicles Derived from Cerebrospinal Fluid of Alzheimer's Disease Patients: A Pilot Study. | Recent studies have highlighted the importance of Aβ and tau-containing extracellular vesicles (EVs) in AD. |
| 33309826 | Proteomic analysis of extracellular vesicles and conditioned medium from human adipose-derived stem/stromal cells and dermal fibroblasts. | No abstract available |
| 33592500 | A Proteomic Approach to Understand the Clinical Significance of Acute Myeloid Leukemia-Derived Extracellular Vesicles Reflecting Essential Characteristics of Leukemia. | No abstract available |
| 33936570 | Quantitative proteomic analysis of extracellular vesicle subgroups isolated by an optimized method combining polymer-based precipitation and size exclusion chromatography. | No abstract available |
| 34576246 | Burn Injury Induces Proinflammatory Plasma Extracellular Vesicles That Associate with Length of Hospital Stay in Women: CRP and SAA1 as Potential Prognostic Indicators. | No abstract available |
| 36146834 | Human Cytomegalovirus Modifies Placental Small Extracellular Vesicle Composition to Enhance Infection of Fetal Neural Cells In Vitro. | No abstract available |
| 37322475 | Comprehensive profiling of extracellular vesicles in uveitis and scleritis enables biomarker discovery and mechanism exploration. | No abstract available |
| 37670049 | Proteomic and functional characterisation of extracellular vesicles from collagen VI deficient human fibroblasts reveals a role in cell motility. | No abstract available |
| 38113368 | In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum. | No abstract available |
| 38207106 | Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity. | No abstract available |
Page 1 of 2Next