Protein detail

PHAG1

Phosphoprotein associated with glycosphingolipid-enriched microdomains 1 (Csk-binding protein) (Transmembrane adapter protein PAG) (Transmembrane phosphoprotein Cbp)

Protein symbol PHAG1	UniProt ID Q9NWQ8	EVMP score 0.63
Frequency 6	Transmembrane count 1	Protein classification Predicted intracellular proteins

Basic Information

Protein Names

Phosphoprotein associated with glycosphingolipid-enriched microdomains 1 (Csk-binding protein) (Transmembrane adapter protein PAG) (Transmembrane phosphoprotein Cbp)

Protein Class

Predicted intracellular proteins

Protein Function

Predicted intracellular proteins

Transmembrane

17..37; Helical; Signal-anchor for type III membrane protein

Transmembrane Count

Ensembl

ENSG00000076641

Entrez Gene Symbol

PAG1

Gene Synonym

CBPPAG

Gene Description

Phosphoprotein membrane anchor with glycosphingolipid microdomains 1

Chromosome

Position

80967810-81112068

Frequency

EVMP Score

0.63

Fluorescence & Localization

Tissue SpecificcervixCell SpecificFibroblastsSingle-Nuclei Brain SpecificfibroblastSecretome LocationSecreted - unknown locationSecretome FunctionNo annotated function

Function & Pathway

Protein Function

Predicted intracellular proteins

Cellular Component

Molecular Function

Reactome

Mediation Categories

Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation

Relations & Evidence

Enzyme-Mediated Modification

6 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
PAG1	FYN	P06241	Y	317	phosphorylation	SIGNORProtMapperRLIMS-P_ProtMapperdbPTMPhosphoSite	dbPTM:10790433 dbPTM:18070987 SIGNOR:16920712 ProtMapper:17905674 dbPTM:19690332 dbPTM:18083107
PAG1	LYN	P07948	Y	317	phosphorylation	SIGNORProtMapperRLIMS-P_ProtMapperdbPTMPhosphoSite	dbPTM:10790433 dbPTM:18070987 SIGNOR:16920712 ProtMapper:17905674 dbPTM:19690332 dbPTM:18083107
PAG1	LYN	P07948	Y	387	phosphorylation	SIGNOR	SIGNOR:16920712
PAG1	LYN	P07948	Y	417	phosphorylation	SIGNOR	SIGNOR:16920712
PAG1	SRC	P12931	Y	317	phosphorylation	PhosphoSitePhosphoSite_ProtMapperProtMapper
PAG1	EGFR	P00533	Y	317	phosphorylation	BEL-Large-Corpus_ProtMapperProtMapper	ProtMapper:16636672

Ligand-Receptor Signaling

21 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
extracellular	extracellular	LOCATE	No	No	No	Yes	No
extracellular	extracellular	OmniPath	No	No	No	Yes	No
intracellular	intracellular	LOCATE	No	No	No	Yes	No
intracellular	intracellular	ComPPI	No	No	No	Yes	No
intracellular	intracellular	GO_Intercell	No	No	No	Yes	No
intracellular	intracellular	OmniPath	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_location	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_topology	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_keyword	No	No	No	Yes	No
transmembrane_predicted	transmembrane	OmniPath	No	No	No	Yes	No

Page 1 of 3Next

Regulatory Interaction Network

3 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
PHAG1	Q9NWQ8	CSK	P41240	Yes	Yes	Yes	HPRDCui2007HINTSignaLink3BioGRIDIntActWangTCRcuration_SignaLink3	HINT:10790433 IntAct:10790433 BioGRID:31125786 SignaLink3:23109003 SignaLink3:10790433 SignaLink3:12614359 HPRD:10790433 SignaLink3:23331499 HINT:32707033 HINT:18070987 HINT:33961781
LYN	P07948	PHAG1	Q9NWQ8	Yes	Yes	No	iPTMnetPhosphoPointSIGNORProtMapperHPRDHINTRLIMS-P_ProtMapperKEAdbPTMphosphoELM_KEAIntActSIGNOR_ProtMapper	dbPTM:10790433 dbPTM:18070987 HINT:10790433 IntAct:18070987 HINT:23866081 KEA:16920712 ProtMapper:17905674 SIGNOR:16920712 dbPTM:19690332 dbPTM:18083107 IntAct:23866081 HINT:18070987 ProtMapper:16920712 HPRD:10790433
SRC	P12931	PHAG1	Q9NWQ8	Yes	No	No	iPTMnetPhosphoSitePhosphoSite_ProtMapperProtMapper	PhosphoSite:10790433

Protein Complex Composition

9 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
BRD7-CBP-SWI\u2013SNF complex	BRD7 PAG1 PHF10 PRMT5 SMARCA2 SMARCA4 SMARCE1	O14744 P51531 P51532 Q8WUB8 Q969G3 Q9NPI1 Q9NWQ8	0:0:0:0:0:0:0	CORUM	CORUM:7376	21447565
DNAAF2-HEATR2-SPAG1 complex	DNAAF2 DNAAF5 SPAG1	Q07617 Q86Y56 Q9NVR5	0:0:0	CORUM	CORUM:7100	29358401
R2SD co-chaperone complex	DNAAF2 RUVBL1 RUVBL2 SPAG1	Q07617 Q9NVR5 Q9Y230 Q9Y265	1:1:6:6	ComplexPortal	intact:EBI-25825394	14755292 29844425
R2SP co-chaperone	PIH1D2 RUVBL1 RUVBL2 SPAG1	Q07617 Q8WWB5 Q9Y230 Q9Y265	1:1:6:6	SIGNORComplexPortal	intact:EBI-25825167SIGNOR:SIGNOR-C517	14755292 31738558 29844425
	CLPB HAX1 ICA1 MAP1LC3A PAG1 TRAM1	O00165 Q05084 Q15629 Q9H078 Q9H492 Q9NWQ8	0:0:0:0:0:0	hu.MAP2
	CLPB HAX1 ICA1 MAP1LC3A PAG1	O00165 Q05084 Q9H078 Q9H492 Q9NWQ8	0:0:0:0:0	hu.MAP2
	ANKHD1 CCDC102A HSPBAP1 MAGEA1 MAGEB3 MAGEB4 MAGEB6 RAD54B SPAG1	O15480 O15481 P43355 Q07617 Q8IWZ3 Q8N7X4 Q96A19 Q96EW2 Q9Y620	0:0:0:0:0:0:0:0:0	hu.MAP2
	ANKHD1 MAGEA1 MAGEB3 MAGEB6 SPAG1	O15480 P43355 Q07617 Q8IWZ3 Q8N7X4	0:0:0:0:0	hu.MAP2
	MAGEA1 MAGEB3 MAGEB6 SPAG1	O15480 P43355 Q07617 Q8N7X4	0:0:0:0	hu.MAP

Isolation & Detection Technology

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion Chromatography	Mass spectrometry	3	35366112 37547182 39304856

Sequence, Structure & Domains

Sequences

Length

432

Mass

46,981

Sequence

MGPAGSLLGSGQMQITLWGSLAAVAIFFVITFLIFLCSSCDREKKPRQHSGDHENLMNVPSDKEMFSRSVTSLATDAPASSEQNGALTNGDILSEDSTLTCMQHYEEVQTSASDLLDSQDSTGKPKCHQSRELPRIPPESAVDTMLTARSVDGDQGLGMEGPYEVLKDSSSQENMVEDCLYETVKEIKEVAAAAHLEKGHSGKAKSTSASKELPGPQTEGKAEFAEYASVDRNKKCRQSVNVESILGNSCDPEEEAPPPVPVKLLDENENLQEKEGGEAEESATDTTSETNKRFSSLSYKSREEDPTLTEEEISAMYSSVNKPGQLVNKSGQSLTVPESTYTSIQGDPQRSPSSCNDLYATVKDFEKTPNSTLPPAGRPSEEPEPDYEAIQTLNREEEKATLGTNGHHGLVPKENDYESISDLQQGRDITRL

3D Structural Models

Domain & Motif Annotations

Compositional Bias

110..122; Polar residues; 220..230; Basic and acidic residues; 316..356; Polar residues

Region

110..137; Disordered; 197..230; Disordered; 244..432; Disordered; 317..320; Interaction with CSK; 430..432; Interaction with NHERF1

Clinical Relevance

Drug Targets

Clinical trial target

Antibody

HPA001632 HPA066527

Interaction Protein

ENSG00000010810ENSG00000103653ENSG00000109062ENSG00000254087

Interaction Count

Interaction Dataset

intact_biogrid