Protein detail
PHAG1
Phosphoprotein associated with glycosphingolipid-enriched microdomains 1 (Csk-binding protein) (Transmembrane adapter protein PAG) (Transmembrane phosphoprotein Cbp)
Entry name PHAG1 | UniProt ID | EVMP confidence score 0.63 |
Supporting publications (n) 6 | Transmembrane count 1 | Protein classification Predicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Phosphoprotein associated with glycosphingolipid-enriched microdomains 1 (Csk-binding protein) (Transmembrane adapter protein PAG) (Transmembrane phosphoprotein Cbp)
Protein Class
Predicted intracellular proteins
Protein Function
Predicted intracellular proteins
Transmembrane
17..37; Helical; Signal-anchor for type III membrane protein
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
CBPPAG
Gene Description
Phosphoprotein membrane anchor with glycosphingolipid microdomains 1
Chromosome
8
Position
80967810-81112068
Supporting publications (n)
6
EVMP confidence score
0.63
Fluorescence & Localization5
Tissue SpecificcervixCell SpecificFibroblastsSingle-Nuclei Brain SpecificfibroblastSecretome LocationSecreted - unknown locationSecretome FunctionNo annotated function
Function & Pathway5
Protein Function
Predicted intracellular proteins
Cellular Component (2)
Molecular Function (3)
Reactome (6)
Mediation Categories (5)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence40
Enzyme-Mediated Modification (6)
6 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| PAG1 | FYN | P06241 | Y | 317 | phosphorylation | SIGNORProtMapperRLIMS-P_ProtMapperdbPTMPhosphoSite | dbPTM:10790433dbPTM:18070987SIGNOR:16920712ProtMapper:17905674dbPTM:19690332dbPTM:18083107 |
| PAG1 | LYN | P07948 | Y | 317 | phosphorylation | SIGNORProtMapperRLIMS-P_ProtMapperdbPTMPhosphoSite | dbPTM:10790433dbPTM:18070987SIGNOR:16920712ProtMapper:17905674dbPTM:19690332dbPTM:18083107 |
| PAG1 | LYN | P07948 | Y | 387 | phosphorylation | SIGNOR | SIGNOR:16920712 |
| PAG1 | LYN | P07948 | Y | 417 | phosphorylation | SIGNOR | SIGNOR:16920712 |
| PAG1 | SRC | P12931 | Y | 317 | phosphorylation | PhosphoSitePhosphoSite_ProtMapperProtMapper | |
| PAG1 | EGFR | P00533 | Y | 317 | phosphorylation | BEL-Large-Corpus_ProtMapperProtMapper | ProtMapper:16636672 |
Ligand-Receptor Signaling (21)
21 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane_tmhmm | transmembrane_predicted | Almen2009 | No | No | No | Yes | No |
Page 3 of 3Previous
Regulatory Interaction Network (3)
3 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| PHAG1 | Q9NWQ8 | CSK | P41240 | Yes | Yes | Yes | HPRDCui2007HINTSignaLink3BioGRIDIntActWangTCRcuration_SignaLink3 | HINT:10790433IntAct:10790433BioGRID:31125786SignaLink3:23109003SignaLink3:10790433SignaLink3:12614359HPRD:10790433SignaLink3:23331499HINT:32707033HINT:18070987HINT:33961781 |
| LYN | P07948 | PHAG1 | Q9NWQ8 | Yes | Yes | No | iPTMnetPhosphoPointSIGNORProtMapperHPRDHINTRLIMS-P_ProtMapperKEAdbPTMphosphoELM_KEAIntActSIGNOR_ProtMapper | dbPTM:10790433dbPTM:18070987HINT:10790433IntAct:18070987HINT:23866081KEA:16920712ProtMapper:17905674SIGNOR:16920712dbPTM:19690332dbPTM:18083107IntAct:23866081HINT:18070987ProtMapper:16920712HPRD:10790433 |
| SRC | P12931 | PHAG1 | Q9NWQ8 | Yes | No | No | iPTMnetPhosphoSitePhosphoSite_ProtMapperProtMapper | PhosphoSite:10790433 |
Protein Complex Composition (9)
9 records.
Sequence, Structure & Domains5
Sequences
Length
432
Mass
46,981
Sequence
MGPAGSLLGSGQMQITLWGSLAAVAIFFVITFLIFLCSSCDREKKPRQHSGDHENLMNVPSDKEMFSRSVTSLATDAPASSEQNGALTNGDILSEDSTLTCMQHYEEVQTSASDLLDSQDSTGKPKCHQSRELPRIPPESAVDTMLTARSVDGDQGLGMEGPYEVLKDSSSQENMVEDCLYETVKEIKEVAAAAHLEKGHSGKAKSTSASKELPGPQTEGKAEFAEYASVDRNKKCRQSVNVESILGNSCDPEEEAPPPVPVKLLDENENLQEKEGGEAEESATDTTSETNKRFSSLSYKSREEDPTLTEEEISAMYSSVNKPGQLVNKSGQSLTVPESTYTSIQGDPQRSPSSCNDLYATVKDFEKTPNSTLPPAGRPSEEPEPDYEAIQTLNREEEKATLGTNGHHGLVPKENDYESISDLQQGRDITRL
Domain & Motif Annotations
Compositional Bias
110..122; Polar residues; 220..230; Basic and acidic residues; 316..356; Polar residues
Region
110..137; Disordered; 197..230; Disordered; 244..432; Disordered; 317..320; Interaction with CSK; 430..432; Interaction with NHERF1
Clinical Relevance5
Supporting Publications6
| PMID | Title | Abstract |
|---|---|---|
| 27312428 | A novel TP53 pathway influences the HGS-mediated exosome formation in colorectal cancer. | No abstract available |
| 30071318 | Changes in the urinary extracellular vesicle proteome are associated with nephronophthisis-related ciliopathies. | No abstract available |
| 38225453 | Deep proteomic analysis of obstetric antiphospholipid syndrome by DIA-MS of extracellular vesicle enriched fractions. | No abstract available |
| 38731868 | The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer. | No abstract available |
| 39873726 | Size-Dependent Separation of Extracellular Vesicle Subtypes with Exodisc Enabling Proteomic Analysis in Prostate Cancer. | No abstract available |
| 40091455 | Potential Role of Menstrual Fluid-Derived Small Extracellular Vesicle Proteins in Endometriosis Pathogenesiss. | No abstract available |