Protein detail
CLC5A
C-type lectin domain family 5 member A (C-type lectin superfamily member 5) (Myeloid DAP12-associating lectin 1) (MDL-1)
Entry name CLC5A | UniProt ID | EVMP confidence score 0.63 |
Supporting publications (n) 9 | Transmembrane count 1 | Protein classification |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information8
Protein Names
C-type lectin domain family 5 member A (C-type lectin superfamily member 5) (Myeloid DAP12-associating lectin 1) (MDL-1)
Protein Function
Predicted intracellular proteins
Transmembrane
5..27; Helical; Signal-anchor for type II membrane protein
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Supporting publications (n)
9
EVMP confidence score
0.63
Fluorescence & Localization1
Cell SpecificEsophageal apical cells
Function & Pathway5
Protein Function
Predicted intracellular proteins
Cellular Component (5)
Molecular Function (2)
Reactome (8)
- R-hsa-2172127 dap12 interactions
- R-hsa-9920588 dengue virus activates modulates innate and adaptive immune responses
- R-hsa-9918481 dengue virus host interactions
- R-hsa-9839923 dengue virus infection
- R-hsa-5663205 infectious disease
- R-hsa-168249 innate immune system
- R-hsa-6798695 neutrophil degranulation
- R-hsa-9824446 viral infection pathways
Mediation Categories (3)
Clinical-translation mediationFusion and delivery mediationImmune mediation
Relations & Evidence38
Ligand-Receptor Signaling (36)
36 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | Almen2009 | No | Yes | No | Yes | No |
| receptor | receptor | CellCellInteractions | No | Yes | No | Yes | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | No | Yes | No |
| transmembrane_phobius | transmembrane_predicted | Almen2009 | No | No | No | Yes | No |
| transmembrane_sosui | transmembrane_predicted | Almen2009 | No | No | No | Yes | No |
| transmembrane_tmhmm | transmembrane_predicted | Almen2009 | No | No | No | Yes | No |
Page 4 of 4Previous
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometryWestern blotting | 1 | 38716512 |
Sequence, Structure & Domains10
Sequences
Length
188
Mass
21,521
Sequence
MNWHMIISGLIVVVLKVVGMTLFLLYFPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9NY25-1; Sequence=Displayed; Name=2; IsoId=Q9NY25-2; Sequence=VSP_012839
Alternative Sequence
116; Missing (in isoform 2)
3D Structural Models
Turn
101..103; 135..137; 143..145
Helix
92..100; 112..122
Beta Strand
76..78; 81..85; 127..133; 138..142; 152..154; 161..173; 179..186
3D Structure
X-ray crystallography (1)
Domain & Motif Annotations
Domain (FT)
78..184; C-type lectin
Supporting Publications9
| PMID | Title | Abstract |
|---|---|---|
| 32230970 | Radiation Exposure of Peripheral Mononuclear Blood Cells Alters the Composition and Function of Secreted Extracellular Vesicles. | No abstract available |
| 32854315 | Proteomic Profiling of Extracellular Vesicles Derived from Cerebrospinal Fluid of Alzheimer's Disease Patients: A Pilot Study. | Recent studies have highlighted the importance of Aβ and tau-containing extracellular vesicles (EVs) in AD. |
| 33592500 | A Proteomic Approach to Understand the Clinical Significance of Acute Myeloid Leukemia-Derived Extracellular Vesicles Reflecting Essential Characteristics of Leukemia. | No abstract available |
| 35763041 | Extracellular Vesicles May Predict Response to Radioembolization and Sorafenib Treatment in Advanced Hepatocellular Carcinoma: An Exploratory Analysis from the SORAMIC Trial. | No abstract available |
| 38014595 | Proteome and immune responses of extracellular vesicles derived from macrophages infected with the periodontal pathogen Tannerella forsythia. | No abstract available |
| 38113368 | In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum. | No abstract available |
| 38895962 | A fast and sensitive size-exclusion chromatography method for plasma extracellular vesicle proteomic analysis. | No abstract available |
| 39001700 | Optimized AF4 combined with density cushion ultracentrifugation enables profiling of high-purity human blood extracellular vesicles. | No abstract available |
| 41307968 | Extracellular Vesicles Define Discrete Nano-Based Niches Within the Human Haematopoietic System. | No abstract available |