Protein detail
SPHK1
Sphingosine kinase 1 (SK 1) (SPK 1) (EC 2.7.1.91) (Acetyltransferase SPHK1) (EC 2.3.1.-)
Entry name SPHK1 | UniProt ID | EVMP confidence score 0.28 |
Supporting publications (n) 1 | Transmembrane count | Protein classification EnzymesMetabolic proteinsPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Sphingosine kinase 1 (SK 1) (SPK 1) (EC 2.7.1.91) (Acetyltransferase SPHK1) (EC 2.3.1.-)
Protein Class (3)
EnzymesMetabolic proteinsPredicted intracellular proteins
Protein Function (3)
- ENZYME proteins:Transferases
- Enzymes
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
SPHK
Gene Description
Sphingosine kinase 1
Chromosome
17
Position
76376584-76387860
Supporting publications (n)
1
EVMP confidence score
0.28
Fluorescence & Localization
Tissue SpecificintestineCell SpecificB-cellsSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell Specificclassical monocyteBlood Lineage Specificdendritic cells
Function & Pathway
Protein Function (3)
- ENZYME proteins:Transferases
- Enzymes
- Predicted intracellular proteins
Cellular Component (11)
- GO:0005634 nucleus
- GO:0005654 nucleoplasm
- GO:0005737 cytoplasm
- GO:0005829 cytosol
- GO:0005886 plasma membrane
- GO:0005905 clathrin-coated pit
- GO:0016020 membrane
- GO:0030139 endocytic vesicle
- GO:0031901 early endosome membrane
- GO:0043231 intracellular membrane-bounded organelle
Page 1 of 2
Molecular Function (12)
- GO:0000287 magnesium ion binding
- GO:0001727 lipid kinase activity
- GO:0003677 DNA binding
- GO:0005515 protein binding
- GO:0005516 calmodulin binding
- GO:0005524 ATP binding
- GO:0008289 lipid binding
- GO:0008481 sphingosine kinase activity
- GO:0016407 acetyltransferase activity
- GO:0017050 D-erythro-sphingosine kinase activity
Page 1 of 2
Biological Process (3)
KEGG (10)
- hsa00600 Sphingolipid metabolism
- KEGG:hsa01100 Metabolic pathways
- KEGG:hsa04020 Calcium signaling pathway
- KEGG:hsa04071 Sphingolipid signaling pathway
- KEGG:hsa04072 Phospholipase D signaling pathway
- KEGG:hsa04148 Efferocytosis
- KEGG:hsa04370 VEGF signaling pathway
- KEGG:hsa04371 Apelin signaling pathway
- KEGG:hsa04666 Fc gamma R-mediated phagosome formation
- KEGG:hsa05152 Tuberculosis
Reactome (15)
- R-hsa-1169410 antimicrobial mechanism of ifn stimulated genes
- R-hsa-390471 association of tric cct with target proteins during biosynthesis
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-8939211 esr mediated signaling
- R-hsa-9009391 extra nuclear estrogen signaling
- R-hsa-913531 interferon signaling
- R-hsa-556833 metabolism of lipids
- R-hsa-9833482 pkr mediated signaling
- R-hsa-391251 protein folding
- R-hsa-9006931 signaling by nuclear receptors
Page 1 of 2
Mediation Categories (5)
Clinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence37
Enzyme-Mediated Modification (12)
12 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| SPHK1 | MAPK1 | P28482 | S | 225 | phosphorylation | SIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:14532121ProtMapper:14532121 |
| SPHK1 | MAPK1 | P28482 | S | 311 | phosphorylation | MIMPKEAPhosphoSite_MIMP | KEA:16522638 |
| SPHK1 | MAPK3 | P27361 | S | 225 | phosphorylation | SIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:14532121ProtMapper:14532121 |
| SPHK1 | MAPK3 | P27361 | S | 311 | phosphorylation | MIMPKEAPhosphoSite_MIMP | KEA:16522638 |
| SPHK1 | PPP2CA | P67775 | S | 225 | dephosphorylation | DEPOD | DEPOD:18852266 |
| SPHK1 | PPP2CA | P67775 | S | 311 | phosphorylation | KEA | KEA:16522638 |
| SPHK1 | PPP2CB | P62714 | S | 225 | dephosphorylation | DEPOD | DEPOD:18852266 |
| SPHK1 | PRKCA | P17252 | S | 225 | phosphorylation | Reactome_ProtMapperProtMapper | |
| SPHK1 | PRKCB | P05771 | S | 225 | phosphorylation | Reactome_ProtMapperProtMapper | |
| SPHK1 | PRKCD | Q05655 | S | 225 | phosphorylation | Reactome_ProtMapperProtMapper |
Page 1 of 2Next
Ligand-Receptor Signaling (11)
11 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | Yes | ||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath | |||||
| transmembrane | transmembrane | GO_Intercell | |||||
| transmembrane | transmembrane | Ramilowski_location | |||||
| transmembrane | transmembrane | OmniPath | |||||
| plasma_membrane | plasma_membrane | UniProt_location | |||||
| plasma_membrane | plasma_membrane | OmniPath |
Page 1 of 2Next
Regulatory Interaction Network (5)
5 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| KS6C1 | Q96S38 | SPHK1 | Q9NYA1 | Yes | Yes | HPRDPhosphoPointSIGNOR | SIGNOR:12077123HPRD:12077123 | |
| E2AK2 | P19525 | SPHK1 | Q9NYA1 | Yes | Yes | REACH_ProtMapperSIGNORProtMapper | SIGNOR:32801355ProtMapper:32801355 | |
| MK03 | P27361 | SPHK1 | Q9NYA1 | Yes | Yes | PhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperKinexus_KEAKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | PhosphoSite:14532121PhosphoSite:18852266PhosphoSite:19830907PhosphoSite:16522638ProtMapper:14532121PhosphoSite:21075214PhosphoSite:15623571SIGNOR:14532121KEA:16522638PhosphoSite:16243846PhosphoSite:19914200 | |
| FHL2 | Q14192 | SPHK1 | Q9NYA1 | Yes | Yes | SPIKE_LCLit-BM-17SIGNOR | Lit-BM-17:16888242SPIKE_LC:16888242SIGNOR:16888242 | |
| MK01 | P28482 | SPHK1 | Q9NYA1 | Yes | Yes | PhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperKinexus_KEAKEASIGNOR_ProtMapperPhosphoSite_ProtMapper | SIGNOR:14532121ProtMapper:14532121KEA:16522638 |
Protein Complex Composition (8)
8 records.
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion ChromatographyImmunoaffinity Capture | Mass spectrometry | 17 | 2708691237211381381133683732247541068253335925003801459531617158407308434130796827821849408407013223097038716512345762463698231237438638 |
Sequence, Structure & Domains
Sequences
Length
384
Mass
42,518
Sequence
MDPAGGPRGVLPRPCRVLVLLNPRGGKGKALQLFRSHVQPLLAEAEISFTLMLTERRNHARELVRSEELGRWDALVVMSGDGLMHEVVNGLMERPDWETAIQKPLCSLPAGSGNALAASLNHYAGYEQVTNEDLLTNCTLLLCRRLLSPMNLLSLHTASGLRLFSVLSLAWGFIADVDLESEKYRRLGEMRFTLGTFLRLAALRTYRGRLAYLPVGRVGSKTPASPVVVQQGPVDAHLVPLEEPVPSHWTVVPDEDFVLVLALLHSHLGSEMFAAPMGRCAAGVMHLFYVRAGVSRAMLLRLFLAMEKGRHMEYECPYLVYVPVVAFRLEPKDGKGVFAVDGELMVSEAVQGQVHPNYFWMVSGCVEPPPSWKPQQMPPPEEPL
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q9NYA1-1; Sequence=Displayed; Name=2; IsoId=Q9NYA1-2; Sequence=VSP_035453; Name=3; IsoId=Q9NYA1-3; Sequence=VSP_047078
Alternative Sequence
1; M -> MSAQVLGFLRSWTPLPLAAPRGPAAAGNDAGAPAATAPGGEGEPHSRPCDARLGSTDKELKAGAAATGSAPTAPGTPWQREPRVEVM (in isoform 2); 3; P -> PVVGCGRGLFGFVFS (in isoform 3)
3D Structural Models
Turn
26..29
Helix
30..37; 39..44; 59..66; 69..71; 81..92; 97..100; 115..123; 131..144; 173..181; 182..190; 191..201; 215..218; 296..305; 306..308; 311..314
Beta Strand
13..21; 47..53; 73..80; 105..109; 146..157; 162..172; 206..214; 230..232; 249..251; 255..266; 285..291; 319..331; 333..335; 337..340; 343..346; 350..362
3D Structure
X-ray crystallography (5)
Domain & Motif Annotations
Motif
147..155; Nuclear export signal 1; 161..169; Nuclear export signal 2
Domain (FT)
12..159; DAGKc
Clinical Relevance
Related Diseases (5)
Biomarker
Terminated; Investigative; Phase 1/2; Phase 1
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 32384937 | Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles. | No related sentences available |