Protein detail
T2R10
Taste receptor type 2 member 10 (T2R10) (Taste receptor family B member 2) (TRB2)
Entry name T2R10 | UniProt ID | EVMP confidence score 0.28 |
Supporting publications (n) 1 | Transmembrane count 7 | Protein classification |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Taste receptor type 2 member 10 (T2R10) (Taste receptor family B member 2) (TRB2)
Protein Function (2)
- G-protein coupled receptors:Family T2R receptors (taste receptor GPCRs)
- G-protein coupled receptors:GPCRs excl olfactory receptors
Transmembrane
7..27; Helical; Name=1; 43..63; Helical; Name=2; 101..121; Helical; Name=3; 127..147; Helical; Name=4; 180..200; Helical; Name=5; 228..248; Helical; Name=6; 258..278; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Supporting publications (n)
1
EVMP confidence score
0.28
Fluorescence & Localization
Cell SpecificEsophageal apical cells
Function & Pathway
Protein Function (2)
- G-protein coupled receptors:Family T2R receptors (taste receptor GPCRs)
- G-protein coupled receptors:GPCRs excl olfactory receptors
Cellular Component (2)
Molecular Function (4)
Biological Process (3)
Reactome (6)
Mediation Categories
Receptor-signaling mediation
Relations & Evidence27
Ligand-Receptor Signaling (26)
26 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | Surfaceome | Yes | ||||
| gpcr | receptor | DGIdb | Yes | ||||
| gpcr | receptor | Almen2009 | Yes | ||||
| taste | receptor | Almen2009 | Yes | ||||
| gpcr | receptor | UniProt_keyword | Yes | ||||
| gpcr | receptor | Surfaceome | Yes | ||||
| tas2r | receptor | Surfaceome | Yes | ||||
| class_t2_taste_2 | receptor | GPCRdb | Yes | ||||
| class_t2_taste_2_sensory | receptor | GPCRdb | Yes | ||||
| class_t2_taste_2_sensory_taste_2 | receptor | GPCRdb | Yes |
Page 1 of 3Next
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 41315767 |
Sequence, Structure & Domains
Sequences
Length
307
Mass
35,365
Sequence
MLRVVEGIFIFVVVSESVFGVLGNGFIGLVNCIDCAKNKLSTIGFILTGLAISRIFLIWIIITDGFIQIFSPNIYASGNLIEYISYFWVIGNQSSMWFATSLSIFYFLKIANFSNYIFLWLKSRTNMVLPFMIVFLLISSLLNFAYIAKILNDYKTKNDTVWDLNMYKSEYFIKQILLNLGVIFFFTLSLITCIFLIISLWRHNRQMQSNVTGLRDSNTEAHVKAMKVLISFIILFILYFIGMAIEISCFTVRENKLLLMFGMTTTAIYPWGHSFILILGNSKLKQASLRVLQQLKCCEKRKNLRVT
Domain & Motif Annotations
Protein Families
G-protein coupled receptor T2R family
Sequence Similarities
Belongs to the G-protein coupled receptor T2R family.
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 32384937 | Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles. | No related sentences available |