Protein detail

CLIC5

Chloride intracellular channel protein 5 (Glutaredoxin-like oxidoreductase CLIC5) (EC 1.8.-.-)

Entry name
CLIC5
UniProt ID
EVMP confidence score
0.88
Supporting publications (n)
24
Transmembrane count
1
Protein classification
Basic Information
Protein Names
Chloride intracellular channel protein 5 (Glutaredoxin-like oxidoreductase CLIC5) (EC 1.8.-.-)
Protein Function (5)
  • Predicted intracellular proteins
  • Potential drug targets
  • Transporters:Transporter channels and pores
  • Disease related genes
  • Human disease related genes:Nervous system diseases:Ear disease
Transmembrane
193..213; Helical; Note=After insertion into the membrane
Transmembrane Count
1
Entrez Gene Symbol
Supporting publications (n)
24
EVMP confidence score
0.88
Fluorescence & Localization
CLIC5 fluorescence
Function & Pathway
Relations & Evidence19

Enzyme-Mediated Modification (1)

1 record.

Substrate Gene SymbolEnzyme Gene SymbolEnzyme UniProt IDResidue TypeResidue OffsetModificationDatabaseReferences
CLIC5FYNP06241Y33phosphorylationPhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper

Ligand-Receptor Signaling (15)

15 records.

CategoryParentDatabaseTransmitterReceiverSecretedPlasma Membrane (Transmembrane)Plasma Membrane (Peripheral)
transmembranetransmembraneUniProt_keyword
transmembranetransmembraneOmniPath
plasma_membraneplasma_membraneUniProt_location
apical_cell_membraneplasma_membraneUniProt_location
plasma_membraneplasma_membraneOmniPath
Page 2 of 2Previous

Regulatory Interaction Network (1)

1 record.

Source Protein SymbolSource UniProt IDTarget Protein SymbolTarget UniProt IDIs DirectedIs StimulationIs InhibitionDatabaseReferences
FYNP06241CLIC5Q9NZA1YesYesPhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperPhosphoSitePhosphoSite_ProtMapperPhosphoSite:10930415SIGNOR:10930415

Protein Complex Composition (1)

1 record.

Component NameComponent Gene SymbolsComponent UniProt IDStoichiometryDatabaseDatabase IDsReferences
CLIC5Q9NZA14PDBPDB:6y2hPDB:8q4jPDB:8q4i

Isolation & Detection Technology (1)

1 record.

EV Isolation MethodDetection MethodNumber of ReferencesReferences
Density Gradient CentrifugationMass spectrometry135495589
Sequence, Structure & Domains

Sequences

Length
410
Mass
46,503
Sequence
MNDEDYSTIYDTIQNERTYEVPDQPEENESPHYDDVHEYLRPENDLYATQLNTHEYDFVSVYTIKGEETSLASVQSEDRGYLLPDEIYSELQEAHPGEPQEDRGISMEGLYSSTQDQQLCAAELQENGSVMKEDLPSPSSFTIQHSKAFSTTKYSCYSDAEGLEEKEGAHMNPEIYLFVKAGIDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQNNAALERGLTKALKKLDDYLNTPLPEEIDANTCGEDKGSRRKFLDGDELTLADCNLLPKLHVVKIVAKKYRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=2; Synonyms=CLIC5B; IsoId=Q9NZA1-1; Sequence=Displayed; Name=1; Synonyms=CLIC5A; IsoId=Q9NZA1-2; Sequence=VSP_000869, VSP_000870; Name=3; IsoId=Q9NZA1-3; Sequence=VSP_044889, VSP_044890, VSP_044891
Alternative Sequence
1..159; Missing (in isoform 1); 1..17; MNDEDYSTIYDTIQNER -> MTDSATANGDDRDPEIE (in isoform 3); 18..176; Missing (in isoform 3); 160..180; AEGLEEKEGAHMNPEIYLFVK -> MTDSATANGDDRDPEIELFVK (in isoform 1); 356..410; IVAKKYRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS -> EQVPLKGMI (in isoform 3)

3D Structural Models

Turn
257..259; 272..276; 400..403
Helix
192..204; 244..254; 268..271; 277..286; 290..292; 293..312; 316..319; 342..362; 371..381; 384..387; 393..399
Beta Strand
175..181; 185..188; 209..213; 233..236; 239..241; 337..339
3D Structure
X-ray crystallography (3)

Domain & Motif Annotations

Motif
191..194; G-site
Domain (CC)
The active G-site contains a monothiol Cys-X-X-Ser motif which mediates glutathione-dependent redox catalysis.; DOMAIN: Members of this family may change from a globular, soluble state to a state where the N-terminal domain is inserted into the membrane and functions as a chloride channel. The redox status of the active cysteine in Cys-X-X-Cys/Ser motif likely determines the capacity to adopt a soluble or membrane-inserted state. A conformation change of the N-terminal domain is thought to expose hydrophobic surfaces that trigger membrane insertion (By similarity).
Domain (FT)
260..400; GST C-terminal
Protein Families
Chloride channel CLIC family
Sequence Similarities
Belongs to the chloride channel CLIC family.
Supporting Publications24
PMIDTitleRelated sentences
37922300Proteomic profiling of urinary extracellular vesicles differentiates breast cancer patients from healthy women.No related sentences available
38136601Identification of Central Nervous System Oncologic Disease Biomarkers in EVs from Cerebrospinal Fluid (CSF) of Pediatric Patients: A Pilot Neuro-Proteomic Study.No related sentences available
38225453Deep proteomic analysis of obstetric antiphospholipid syndrome by DIA-MS of extracellular vesicle enriched fractions.No related sentences available
38490958Proteomic analysis of ascitic extracellular vesicles describes tumour microenvironment and predicts patient survival in ovarian cancer.No related sentences available
38564289Proteomic profiles of peritoneal fluid-derived small extracellular vesicles correlate with patient outcome in ovarian cancer.No related sentences available
38731868The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer.No related sentences available
38938674Gestational age at birth influences protein and RNA content in human milk extracellular vesicles.No related sentences available
39290459Urinary extracellular vesicles as a monitoring tool for renal damage in patients not meeting criteria for chronic kidney disease.No related sentences available
39436214Human ovarian extracellular vesicles proteome from polycystic ovary syndrome patients associate with follicular development alterations.No related sentences available
40091455Potential Role of Menstrual Fluid-Derived Small Extracellular Vesicle Proteins in Endometriosis Pathogenesiss.No related sentences available
Page 2 of 3PreviousNext