Protein detail
CLIC5
Chloride intracellular channel protein 5 (Glutaredoxin-like oxidoreductase CLIC5) (EC 1.8.-.-)
Entry name CLIC5 | UniProt ID | EVMP confidence score 0.88 |
Supporting publications (n) 24 | Transmembrane count 1 | Protein classification |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Chloride intracellular channel protein 5 (Glutaredoxin-like oxidoreductase CLIC5) (EC 1.8.-.-)
Protein Function (5)
- Predicted intracellular proteins
- Potential drug targets
- Transporters:Transporter channels and pores
- Disease related genes
- Human disease related genes:Nervous system diseases:Ear disease
Transmembrane
193..213; Helical; Note=After insertion into the membrane
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Supporting publications (n)
24
EVMP confidence score
0.88
Fluorescence & Localization
Function & Pathway
Protein Function (5)
- Predicted intracellular proteins
- Potential drug targets
- Transporters:Transporter channels and pores
- Disease related genes
- Human disease related genes:Nervous system diseases:Ear disease
Cellular Component (9)
Molecular Function (3)
Biological Process (3)
Reactome (3)
Mediation Categories
Fusion and delivery mediation
Relations & Evidence19
Enzyme-Mediated Modification (1)
1 record.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| CLIC5 | FYN | P06241 | Y | 33 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper |
Ligand-Receptor Signaling (15)
15 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | UniProt_keyword | |||||
| transmembrane | transmembrane | OmniPath | |||||
| plasma_membrane | plasma_membrane | UniProt_location | |||||
| apical_cell_membrane | plasma_membrane | UniProt_location | |||||
| plasma_membrane | plasma_membrane | OmniPath |
Page 2 of 2Previous
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| FYN | P06241 | CLIC5 | Q9NZA1 | Yes | Yes | PhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperPhosphoSitePhosphoSite_ProtMapper | PhosphoSite:10930415SIGNOR:10930415 |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Density Gradient Centrifugation | Mass spectrometry | 1 | 35495589 |
Sequence, Structure & Domains
Sequences
Length
410
Mass
46,503
Sequence
MNDEDYSTIYDTIQNERTYEVPDQPEENESPHYDDVHEYLRPENDLYATQLNTHEYDFVSVYTIKGEETSLASVQSEDRGYLLPDEIYSELQEAHPGEPQEDRGISMEGLYSSTQDQQLCAAELQENGSVMKEDLPSPSSFTIQHSKAFSTTKYSCYSDAEGLEEKEGAHMNPEIYLFVKAGIDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQNNAALERGLTKALKKLDDYLNTPLPEEIDANTCGEDKGSRRKFLDGDELTLADCNLLPKLHVVKIVAKKYRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=2; Synonyms=CLIC5B; IsoId=Q9NZA1-1; Sequence=Displayed; Name=1; Synonyms=CLIC5A; IsoId=Q9NZA1-2; Sequence=VSP_000869, VSP_000870; Name=3; IsoId=Q9NZA1-3; Sequence=VSP_044889, VSP_044890, VSP_044891
Alternative Sequence
1..159; Missing (in isoform 1); 1..17; MNDEDYSTIYDTIQNER -> MTDSATANGDDRDPEIE (in isoform 3); 18..176; Missing (in isoform 3); 160..180; AEGLEEKEGAHMNPEIYLFVK -> MTDSATANGDDRDPEIELFVK (in isoform 1); 356..410; IVAKKYRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS -> EQVPLKGMI (in isoform 3)
3D Structural Models
Turn
257..259; 272..276; 400..403
Helix
192..204; 244..254; 268..271; 277..286; 290..292; 293..312; 316..319; 342..362; 371..381; 384..387; 393..399
Beta Strand
175..181; 185..188; 209..213; 233..236; 239..241; 337..339
3D Structure
X-ray crystallography (3)
Domain & Motif Annotations
Motif
191..194; G-site
Domain (CC)
The active G-site contains a monothiol Cys-X-X-Ser motif which mediates glutathione-dependent redox catalysis.; DOMAIN: Members of this family may change from a globular, soluble state to a state where the N-terminal domain is inserted into the membrane and functions as a chloride channel. The redox status of the active cysteine in Cys-X-X-Cys/Ser motif likely determines the capacity to adopt a soluble or membrane-inserted state. A conformation change of the N-terminal domain is thought to expose hydrophobic surfaces that trigger membrane insertion (By similarity).
Domain (FT)
260..400; GST C-terminal
Protein Families
Chloride channel CLIC family
Sequence Similarities
Belongs to the chloride channel CLIC family.
Supporting Publications24
| PMID | Title | Related sentences |
|---|---|---|
| 40098346 | Toward Identification of Markers for Brain-Derived Extracellular Vesicles in Cerebrospinal Fluid: A Large-Scale, Unbiased Analysis Using Proximity Extension Assays. | No related sentences available |
| 40311616 | Integrative proteomic profiling of tumor and plasma extracellular vesicles identifies a diagnostic biomarker panel for colorectal cancer. | No related sentences available |
| 40750896 | The exosomal protein biomarkers auxiliary in diagnosis of interstitial lung disease. | No related sentences available |
| 41201090 | Identification of molecular markers and exploration of the oncogenic role of exomeres in hepatocellular carcinoma. | No related sentences available |
Page 3 of 3Previous