Protein detail

MAT2B

Methionine adenosyltransferase 2 subunit beta (Methionine adenosyltransferase II beta) (MAT II beta) (Putative dTDP-4-keto-6-deoxy-D-glucose 4-reductase)

Entry name MAT2B	UniProt ID Q9NZL9	EVMP confidence score 0.60
Supporting publications (n) 18	Transmembrane count	Protein classification Metabolic proteinsPredicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Methionine adenosyltransferase 2 subunit beta (Methionine adenosyltransferase II beta) (MAT II beta) (Putative dTDP-4-keto-6-deoxy-D-glucose 4-reductase)

Protein Class (2)

Metabolic proteinsPredicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000038274

Entrez Gene Symbol

MAT2B

Gene Synonym (2)

MATIIbetaSDR23E1

Gene Description

Methionine adenosyltransferase 2B

Chromosome

Position

163503114-163519558

Supporting publications (n)

EVMP confidence score

0.60

Fluorescence & Localization4

Tissue SpecifickidneyCell SpecificDistal convoluted tubule cellsSingle-Nuclei Brain Specificfibroblast

Function & Pathway8

Protein Function

Predicted intracellular proteins

Cellular Component (4)

Molecular Function (3)

Biological Process (3)

KEGG (5)

Reactome (6)

Canonical Pathways

M243 Pid arf 3pathway

Mediation Categories

Metabolism mediation

Relations & Evidence15

Ligand-Receptor Signaling (4)

4 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Regulatory Interaction Network (1)

1 record.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
MAT2B	Q9NZL9	GIT1	Q9Y2X7	Yes	Yes	No	SIGNOR	SIGNOR:23325601

Protein Complex Composition (9)

9 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
Methionine adenosyltransferase alpha2 beta-v1	MAT2A MAT2B	P31153 Q9NZL9	4:2	CORUMComplexPortalPDB	CORUM:7191PDB:4kttintact:EBI-12685541PDB:4ktvPDB:4ndn	25075345 14755292
	DENND1A DLGAP4 MAT2B PICALM PTPRF TRIM25 TTC5	P10586 Q13492 Q14258 Q8N0Z6 Q8TEH3 Q9NZL9 Q9Y2H0	0:0:0:0:0:0:0	hu.MAP2
	DLGAP4 FABP4 HSPE1 IL1F10 MAT2B OAZ3 ODC1 PTGR1 RGN RMDN1	P11926 P15090 P61604 Q14914 Q15493 Q8WWZ1 Q96DB5 Q9NZL9 Q9UMX2 Q9Y2H0	0:0:0:0:0:0:0:0:0:0	hu.MAP2
	MAT1A MAT2A MAT2B	P31153 Q00266 Q9NZL9	0:0:0	hu.MAPhu.MAP2
	EFL1 FAM98B HNRNPM MAT2B RTCB RTRAF	P52272 Q52LJ0 Q7Z2Z2 Q9NZL9 Q9Y224 Q9Y3I0	0:0:0:0:0:0	hu.MAP2
	MAT2B TNS3	Q68CZ2 Q9NZL9	0:0	Havugimana2012	Havugimana2012:C_78
	MAT2B	Q9NZL9	5	PDB	PDB:2ydx
	MAT2B ZNFX1	Q9NZL9 Q9P2E3	0:0	hu.MAP
	DLGAP4 MAT2B	Q9NZL9 Q9Y2H0	0:0	hu.MAP2

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry	1	27894104

Sequence, Structure & Domains12

Sequences

Length

334

Mass

37,552

Sequence

MVGREKELSIHFVPGSCRLVEEEVNIPNRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRPITDSPVLGAQRPRNAQLDCSKLETLGIGQRTPFRIGIKESLWPFLIDKRWRQTVFH

Alternative Products

Event=Alternative splicing; Named isoforms=5; Name=1; IsoId=Q9NZL9-1; Sequence=Displayed; Name=2; IsoId=Q9NZL9-2; Sequence=VSP_025534; Name=3; IsoId=Q9NZL9-3; Sequence=VSP_025538, VSP_025539; Name=4; IsoId=Q9NZL9-4; Sequence=VSP_025534, VSP_025540; Name=5; IsoId=Q9NZL9-5; Sequence=VSP_025535, VSP_025536, VSP_025537

Alternative Sequence

1..21; MVGREKELSIHFVPGSCRLVE -> MPEMPEDMEQ (in isoform 2 and isoform 4); 1..20; MVGREKELSIHFVPGSCRLV -> MPEMPEDMEQ (in isoform 5); 87..93; PHVIVHC -> VLLTALS (in isoform 5); 94..334; Missing (in isoform 5); 241..259; DPSIKGTFHWSGNEQMTKY -> VRRIPESCLSEGPLCLFHA (in isoform 3); 260..334; Missing (in isoform 3); 279..295; Missing (in isoform 4)

3D Structural Models

Turn

35..37; 50..52; 60..62; 64..66; 330..333

Helix

39..49; 79..85; 99..104; 106..113; 115..126; 137..139; 158..173; 192..194; 198..200; 201..205; 224..239; 258..268; 298..302; 311..319; 320..322; 324..327

Beta Strand

30..34; 54..58; 67..69; 88..92; 130..136; 142..144; 178..182; 184..186; 207..209; 211..214; 216..219; 246..249; 276..279; 285..287

3D Structure

X-ray crystallography (5)

Domain & Motif Annotations

Region

319..334; Required for interaction with MAT2A

Protein Families (2)

DTDP-4-dehydrorhamnose reductase family
MAT2B subfamily

Sequence Similarities

Belongs to the dTDP-4-dehydrorhamnose reductase family. MAT2B subfamily.

Clinical Relevance4

Antibody (2)

HPA037721 HPA037722

Interaction Protein

ENSG00000168906

Interaction Count

Interaction Dataset

intact_biogrid

Supporting Publications18

PMID	Title	Abstract
37322475	Comprehensive profiling of extracellular vesicles in uveitis and scleritis enables biomarker discovery and mechanism exploration.	No abstract available
37926756	Extracellular vesicles from non-neuroendocrine SCLC cells promote adhesion and survival of neuroendocrine SCLC cells.	No abstract available
38113368	In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum.	No abstract available
38207106	Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity.	No abstract available
39207047	The trajectory of vesicular proteomic signatures from HBV-HCC by chitosan-magnetic bead-based separation and DIA-proteomic analysis.	No abstract available
40189497	Small extracellular vesicle-based one-step high-throughput microfluidic platform for epithelial ovarian cancer diagnosis.	No abstract available
40831280	Syntenin Controls Extracellular Vesicle-Induced Tumour Migration by Regulating the Expression of Adhesion Proteins on Small Extracellular Vesicles.	No abstract available
41068253	Identification of plasma extracellular vesicle protein biomarkers in diabetic retinopathy progression.	No abstract available

Page 2 of 2Previous