Protein detail
MAT2B
Methionine adenosyltransferase 2 subunit beta (Methionine adenosyltransferase II beta) (MAT II beta) (Putative dTDP-4-keto-6-deoxy-D-glucose 4-reductase)
Entry name MAT2B | UniProt ID | EVMP confidence score 0.60 |
Supporting publications (n) 18 | Transmembrane count | Protein classification Metabolic proteinsPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Methionine adenosyltransferase 2 subunit beta (Methionine adenosyltransferase II beta) (MAT II beta) (Putative dTDP-4-keto-6-deoxy-D-glucose 4-reductase)
Protein Class (2)
Metabolic proteinsPredicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
MATIIbetaSDR23E1
Gene Description
Methionine adenosyltransferase 2B
Chromosome
5
Position
163503114-163519558
Supporting publications (n)
18
EVMP confidence score
0.60
Fluorescence & Localization
Tissue SpecifickidneyCell SpecificDistal convoluted tubule cellsSingle-Nuclei Brain Specificfibroblast
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component (4)
Molecular Function (3)
Biological Process (3)
KEGG (5)
Reactome (6)
Canonical Pathways
M243 Pid arf 3pathway
Mediation Categories
Metabolism mediation
Relations & Evidence15
Ligand-Receptor Signaling (4)
4 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | |||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | OmniPath |
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| MAT2B | Q9NZL9 | GIT1 | Q9Y2X7 | Yes | Yes | SIGNOR | SIGNOR:23325601 |
Protein Complex Composition (9)
9 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| Methionine adenosyltransferase alpha2 beta-v1 | MAT2AMAT2B | P31153Q9NZL9 | 4:2 | CORUMComplexPortalPDB | CORUM:7191PDB:4kttintact:EBI-12685541PDB:4ktvPDB:4ndn | 2507534514755292 |
| DENND1ADLGAP4MAT2BPICALMPTPRFTRIM25TTC5 | P10586Q13492Q14258Q8N0Z6Q8TEH3Q9NZL9Q9Y2H0 | 0:0:0:0:0:0:0 | hu.MAP2 | |||
| DLGAP4FABP4HSPE1IL1F10MAT2BOAZ3ODC1PTGR1RGNRMDN1 | P11926P15090P61604Q14914Q15493Q8WWZ1Q96DB5Q9NZL9Q9UMX2Q9Y2H0 | 0:0:0:0:0:0:0:0:0:0 | hu.MAP2 | |||
| MAT1AMAT2AMAT2B | P31153Q00266Q9NZL9 | 0:0:0 | hu.MAPhu.MAP2 | |||
| EFL1FAM98BHNRNPMMAT2BRTCBRTRAF | P52272Q52LJ0Q7Z2Z2Q9NZL9Q9Y224Q9Y3I0 | 0:0:0:0:0:0 | hu.MAP2 | |||
| MAT2BTNS3 | Q68CZ2Q9NZL9 | 0:0 | Havugimana2012 | Havugimana2012:C_78 | ||
| MAT2B | Q9NZL9 | 5 | PDB | PDB:2ydx | ||
| MAT2BZNFX1 | Q9NZL9Q9P2E3 | 0:0 | hu.MAP | |||
| DLGAP4MAT2B | Q9NZL9Q9Y2H0 | 0:0 | hu.MAP2 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry | 1 | 27894104 |
Sequence, Structure & Domains
Sequences
Length
334
Mass
37,552
Sequence
MVGREKELSIHFVPGSCRLVEEEVNIPNRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRPITDSPVLGAQRPRNAQLDCSKLETLGIGQRTPFRIGIKESLWPFLIDKRWRQTVFH
Alternative Products
Event=Alternative splicing; Named isoforms=5; Name=1; IsoId=Q9NZL9-1; Sequence=Displayed; Name=2; IsoId=Q9NZL9-2; Sequence=VSP_025534; Name=3; IsoId=Q9NZL9-3; Sequence=VSP_025538, VSP_025539; Name=4; IsoId=Q9NZL9-4; Sequence=VSP_025534, VSP_025540; Name=5; IsoId=Q9NZL9-5; Sequence=VSP_025535, VSP_025536, VSP_025537
Alternative Sequence
1..21; MVGREKELSIHFVPGSCRLVE -> MPEMPEDMEQ (in isoform 2 and isoform 4); 1..20; MVGREKELSIHFVPGSCRLV -> MPEMPEDMEQ (in isoform 5); 87..93; PHVIVHC -> VLLTALS (in isoform 5); 94..334; Missing (in isoform 5); 241..259; DPSIKGTFHWSGNEQMTKY -> VRRIPESCLSEGPLCLFHA (in isoform 3); 260..334; Missing (in isoform 3); 279..295; Missing (in isoform 4)
3D Structural Models
Turn
35..37; 50..52; 60..62; 64..66; 330..333
Helix
39..49; 79..85; 99..104; 106..113; 115..126; 137..139; 158..173; 192..194; 198..200; 201..205; 224..239; 258..268; 298..302; 311..319; 320..322; 324..327
Beta Strand
30..34; 54..58; 67..69; 88..92; 130..136; 142..144; 178..182; 184..186; 207..209; 211..214; 216..219; 246..249; 276..279; 285..287
3D Structure
X-ray crystallography (5)
Domain & Motif Annotations
Region
319..334; Required for interaction with MAT2A
Protein Families (2)
- DTDP-4-dehydrorhamnose reductase family
- MAT2B subfamily
Sequence Similarities
Belongs to the dTDP-4-dehydrorhamnose reductase family. MAT2B subfamily.
Clinical Relevance
Supporting Publications18
| PMID | Title | Related sentences |
|---|---|---|
| 37322475 | Comprehensive profiling of extracellular vesicles in uveitis and scleritis enables biomarker discovery and mechanism exploration. | No related sentences available |
| 37926756 | Extracellular vesicles from non-neuroendocrine SCLC cells promote adhesion and survival of neuroendocrine SCLC cells. | No related sentences available |
| 38113368 | In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum. | No related sentences available |
| 38207106 | Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity. | No related sentences available |
| 39207047 | The trajectory of vesicular proteomic signatures from HBV-HCC by chitosan-magnetic bead-based separation and DIA-proteomic analysis. | No related sentences available |
| 40189497 | Small extracellular vesicle-based one-step high-throughput microfluidic platform for epithelial ovarian cancer diagnosis. | No related sentences available |
| 40831280 | Syntenin Controls Extracellular Vesicle-Induced Tumour Migration by Regulating the Expression of Adhesion Proteins on Small Extracellular Vesicles. | No related sentences available |
| 41068253 | Identification of plasma extracellular vesicle protein biomarkers in diabetic retinopathy progression. | No related sentences available |
Page 2 of 2Previous