Protein detail
PK2L2
Polycystin-2-like protein 2 (Polycystin-2L2) (Polycystic kidney disease 2-like 2 protein) (Polycystin-L2)
Entry name PK2L2 | UniProt ID | EVMP score 0.50 |
Frequency 1 | Transmembrane count 6 | Protein classification Predicted intracellular proteinsPredicted membrane proteinsVoltage-gated ion channels |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Polycystin-2-like protein 2 (Polycystin-2L2) (Polycystic kidney disease 2-like 2 protein) (Polycystin-L2)
Protein Class
Predicted intracellular proteinsPredicted membrane proteinsVoltage-gated ion channels
Protein Function
- Voltage-gated ion channels:Transient Receptor Potential Channels
- Predicted intracellular proteins
Transmembrane
32..52; Helical; 277..297; Helical; 315..335; Helical; 361..381; Helical; 407..427; Helical; 470..490; Helical
Transmembrane Count
6
Ensembl
Entrez Gene Symbol
Gene Synonym
TRPP5
Gene Description
Polycystin 2 like 2, transient receptor potential cation channel
Chromosome
5
Position
137887968-137942747
Frequency
1
EVMP Score
0.50
Fluorescence & Localization
Function & Pathway
Protein Function
- Voltage-gated ion channels:Transient Receptor Potential Channels
- Predicted intracellular proteins
Cellular Component
Molecular Function
Canonical Pathways
- M3468 Naba ecm regulators
- M5885 Naba matrisome associated
- M5889 Naba matrisome
Mediation Categories
Fusion and delivery mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
20 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transporter | transporter | OmniPath | No | Yes | No | No | No |
| ion_channel | ion_channel | OmniPath | No | Yes | No | No | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | No | No |
| transmembrane | transmembrane | LOCATE | No | No | No | No | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | No | No |
| transmembrane | transmembrane | OmniPath | No | No | No | No | No |
| receptor | receptor | scConnect | No | Yes | No | No | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | No | No | No |
Page 2 of 2Previous
Regulatory Interaction Network
0 records.
Protein Complex Composition
0 records.
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion Chromatography | Flow cytometry | 1 | 35611462 |
Sequence, Structure & Domains
Sequences
Length
624
Mass
73,790
Sequence
MAEASRWHRGGASKHKLHYRKEVEITTTLQELLLYFIFLINLCILTFGMVNPHMYYLNKVMSSLFLDTSVPGEERTNFKSIRSITDFWKFMEGPLLEGLYWDSWYNNQQLYNLKNSSRIYYENILLGVPRVRQLKVRNNTCKVYSSFQSLMSECYGKYTSANEDLSNFGLQINTEWRYSTSNTNSPWHWGFLGVYRNGGYIFTLSKSKSETKNKFIDLRLNSWITRGTRVIFIDFSLYNANVNLFCIIRLVAEFPATGGILTSWQFYSVKLLRYVSYYDYFIASCEITFCIFLFVFTTQEVKKIKEFKSAYFKSIWNWLELLLLLLCFVAVSFNTYYNVQIFLLLGQLLKSTEKYSDFYFLACWHIYYNNIIAITIFFAWIKIFKFISFNKTMSQLSSTLSRCVKDIVGFAIMFFIIFFAYAQLGFLVFGSQVDDFSTFQNSIFAQFRIVLGDFNFAGIQQANPILGPIYFITFIFFVFFVLLNMFLAIINDTYSEVKADYSIGRRLDFELGKMIKQSYKNVLEKFRLKKAQKDEDKKTKGSGDLAEQARREGFDENEIQNAEQMKKWKERLEKKYYSMEIQDDYQPVTQEEFRELFLYAVELEKELHYINLKLNQVVRKVSAL
Alternative Products
Event=Alternative splicing; Named isoforms=7; Comment=Experimental confirmation may be lacking for some isoforms.; Name=1; IsoId=Q9NZM6-1; Sequence=Displayed; Name=2; Synonyms=PKD2L2b; IsoId=Q9NZM6-2; Sequence=VSP_004732, VSP_004735; Name=3; Synonyms=PKD2L2a; IsoId=Q9NZM6-3; Sequence=VSP_004736, VSP_004737; Name=4; Synonyms=PKD2L2c; IsoId=Q9NZM6-4; Sequence=VSP_004733, VSP_004734; Name=5; IsoId=Q9NZM6-5; Sequence=VSP_035775; Name=6; IsoId=Q9NZM6-6; Sequence=VSP_045582; Name=7; IsoId=Q9NZM6-7; Sequence=VSP_045581
Alternative Sequence
11..44; Missing (in isoform 2); 12..23; ASKHKLHYRKEV -> YVISIFGHFCAW (in isoform 4); 24..624; Missing (in isoform 4); 45..57; LTFGMVNPHMYYL -> CYVISIFGHFCAW (in isoform 3); 45; L -> V (in isoform 2); 58..624; Missing (in isoform 3); 326..347; Missing (in isoform 7); 383..483; Missing (in isoform 6); 595..624; ELFLYAVELEKELHYINLKLNQVVRKVSAL -> DGTTTKYKMRFSECLTKRI (in isoform 5)
3D Structural Models
Domain & Motif Annotations
Coiled Coil
556..576
Protein Families
Polycystin family
Sequence Similarities
Belongs to the polycystin family.