Protein detail
FLRT1
Leucine-rich repeat transmembrane protein FLRT1 (Fibronectin-like domain-containing leucine-rich transmembrane protein 1)
Entry name FLRT1 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification Predicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Leucine-rich repeat transmembrane protein FLRT1 (Fibronectin-like domain-containing leucine-rich transmembrane protein 1)
Protein Class
Predicted membrane proteins
Transmembrane
553..573; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
MGC21624SPG68
Gene Description
Fibronectin leucine rich transmembrane protein 1
Chromosome
11
Position
64035931-64119173
Supporting publications (n)
1
EVMP confidence score
0.53
Fluorescence & Localization
Tissue Specificbone marrowCell SpecificCardiomyocytesSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell SpecificneutrophilBlood Lineage Specificgranulocytes
Function & Pathway
Cellular Component (11)
- GO:0005615 extracellular space
- GO:0005789 endoplasmic reticulum membrane
- GO:0005886 plasma membrane
- GO:0005911 cell-cell junction
- GO:0005925 focal adhesion
- GO:0030659 cytoplasmic vesicle membrane
- GO:0031012 extracellular matrix
- GO:0031410 cytoplasmic vesicle
- GO:0032809 neuronal cell body membrane
- GO:0044306 neuron projection terminus
Page 1 of 2
Molecular Function
Biological Process (3)
Reactome (4)
Canonical Pathways (2)
- M79 Pid trail pathway
- M145 Pid p53 downstream pathway
Mediation Categories (2)
Adhesion and uptake mediationReceptor-signaling mediation
Relations & Evidence42
Ligand-Receptor Signaling (38)
38 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| cell_surface_ligand | cell_surface_ligand | OmniPath | Yes | Yes | Yes | ||
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | Yes | Yes | |
| cell_adhesion | cell_adhesion | Zhong2015 | Yes | Yes | Yes | Yes | |
| icam | cell_adhesion | Zhong2015 | Yes | Yes | Yes | Yes | |
| adhesion | adhesion | OmniPath | Yes | Yes | Yes | Yes | |
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | Yes | Yes | |
| transmembrane | transmembrane | UniProt_location | Yes | Yes | |||
| transmembrane | transmembrane | UniProt_topology | Yes | Yes | |||
| transmembrane | transmembrane | UniProt_keyword | Yes | Yes | |||
| transmembrane | transmembrane | CellPhoneDB | Yes | Yes |
Protein Complex Composition (3)
3 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| TENM2_FLRT1_complex | FLRT1TENM2 | Q9NT68Q9NZU1 | 1:1 | CellPhoneDBCellChatDB | CellPhoneDB:TENM2_FLRT1_complex | |
| TENM3_FLRT1_complex | FLRT1TENM3 | Q9NZU1Q9P273 | 1:1 | CellPhoneDBCellChatDB | CellPhoneDB:TENM3_FLRT1_complex | |
| TENM4_FLRT1_complex | FLRT1TENM4 | Q6N022Q9NZU1 | 1:1 | CellPhoneDBCellChatDB | CellPhoneDB:TENM4_FLRT1_complex |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion ChromatographyImmunoaffinity Capture | Western blotting | 1 | 40098346 |
Sequence, Structure & Domains
Sequences
Length
674
Mass
74,088
Sequence
MVVAHPTATATTTPTATVTATVVMTTATMDLRDWLFLCYGLIAFLTEVIDSTTCPSVCRCDNGFIYCNDRGLTSIPADIPDDATTLYLQNNQINNAGIPQDLKTKVNVQVIYLYENDLDEFPINLPRSLRELHLQDNNVRTIARDSLARIPLLEKLHLDDNSVSTVSIEEDAFADSKQLKLLFLSRNHLSSIPSGLPHTLEELRLDDNRISTIPLHAFKGLNSLRRLVLDGNLLANQRIADDTFSRLQNLTELSLVRNSLAAPPLNLPSAHLQKLYLQDNAISHIPYNTLAKMRELERLDLSNNNLTTLPRGLFDDLGNLAQLLLRNNPWFCGCNLMWLRDWVKARAAVVNVRGLMCQGPEKVRGMAIKDITSEMDECFETGPQGGVANAAAKTTASNHASATTPQGSLFTLKAKRPGLRLPDSNIDYPMATGDGAKTLAIHVKALTADSIRITWKATLPASSFRLSWLRLGHSPAVGSITETLVQGDKTEYLLTALEPKSTYIICMVTMETSNAYVADETPVCAKAETADSYGPTTTLNQEQNAGPMASLPLAGIIGGAVALVFLFLVLGAICWYVHQAGELLTRERAYNRGSRKKDDYMESGTKKDNSILEIRGPGLQMLPINPYRAKEEYVVHTIFPSNGSSLCKATHTIGYGTTRGYRDGGIPDIDYSYT
Alternative Products
Event=Alternative initiation; Named isoforms=2; Name=2; IsoId=Q9NZU1-2; Sequence=Displayed; Name=1; IsoId=Q9NZU1-1; Sequence=VSP_062134
Alternative Sequence
1..28; Missing (in isoform 1)
Domain & Motif Annotations
Repeat
82..103; LRR 1; 107..127; LRR 2; 128..149; LRR 3; 152..173; LRR 4; 178..199; LRR 5; 200..220; LRR 6; 223..246; LRR 7; 249..269; LRR 8; 271..292; LRR 9; 295..316; LRR 10
Domain (FT)
49..81; LRRNT; 328..380; LRRCT; 437..532; Fibronectin type-III
Clinical Relevance
Antibody
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 39363010 | Proteomic analysis of plasma-derived extracellular vesicles: pre- and postprandial comparisons. | No related sentences available |