Protein detail
LMCD1
LIM and cysteine-rich domains protein 1 (Dyxin)
Entry name LMCD1 | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 4 | Transmembrane count | Protein classification Predicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information10
Protein Names
LIM and cysteine-rich domains protein 1 (Dyxin)
Protein Class
Predicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Description
LIM and cysteine rich domains 1
Chromosome
3
Position
8501807-8574668
Supporting publications (n)
4
EVMP confidence score
0.38
Fluorescence & Localization8
Tissue Specificlymphoid tissueCell SpecificInnate lymphoid cellsSingle-Nuclei Brain SpecificleukocyteBlood Cell SpecificgdT-cellBlood Lineage SpecificNK-cellsSecretome LocationIntracellular and membraneSecretome FunctionReceptor
Function & Pathway6
Protein Function
Predicted intracellular proteins
Cellular Component (3)
Molecular Function (3)
Biological Process (3)
Mediation Categories (2)
Metabolism mediationReceptor-signaling mediation
Relations & Evidence7
Ligand-Receptor Signaling (5)
5 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Size Exclusion Chromatography | Mass spectrometry | 1 | 31414377 |
Sequence, Structure & Domains9
Sequences
Length
365
Mass
40,833
Sequence
MAKVAKDLNPGVKKMSLGQLQSARGVACLGCKGTCSGFEPHSWRKICKSCKCSQEDHCLTSDLEDDRKIGRLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELIPKEKQPVTGTEGAFYRRRQLMHQLPIYDQDPSRCRGLLENELKLMEEFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGAETTAATTNGSLSDPSKEVEYVCELCKGAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSEPLVDLIYFWKDGAPWCGRHYCESLRPRCSGCDEIIFAEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVTKGQLLCPTCSKSKRS
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9NZU5-1; Sequence=Displayed; Name=2; IsoId=Q9NZU5-2; Sequence=VSP_053895
Alternative Sequence
1..73; Missing (in isoform 2)
Domain & Motif Annotations
Compositional Bias
208..220; Basic and acidic residues
Domain (CC)
The LIM zinc-binding domains and the Cys-rich region mediate interaction with GATA6..
Domain (FT)
99..206; PET; 241..306; LIM zinc-binding 1; 307..365; LIM zinc-binding 2
Region
200..235; Disordered
Clinical Relevance1
Antibody
Supporting Publications4
| PMID | Title | Abstract |
|---|---|---|
| 30915084 | Extracellular Vesicles Mediate Mesenchymal Stromal Cell-Dependent Regulation of B Cell PI3K-AKT Signaling Pathway and Actin Cytoskeleton. | No abstract available |
| 31805958 | Proteomic analysis of cerebrospinal fluid extracellular vesicles reveals synaptic injury, inflammation, and stress response markers in HIV patients with cognitive impairment. | No abstract available |
| 38207106 | Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity. | No abstract available |
| 40985879 | TurboID-Mediated Profiling of Glioblastoma-Derived Extracellular Vesicle Cargo Proteins. | No abstract available |