Protein detail

ADA22

Disintegrin and metalloproteinase domain-containing protein 22 (ADAM 22) (Metalloproteinase-disintegrin ADAM22-3) (Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 2)

Entry name ADA22	UniProt ID Q9P0K1	EVMP confidence score 0.25
Supporting publications (n) 3	Transmembrane count 1	Protein classification

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information8

Protein Names

Disintegrin and metalloproteinase domain-containing protein 22 (ADAM 22) (Metalloproteinase-disintegrin ADAM22-3) (Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 2)

Protein Function (3)

Human disease related genes:Nervous system diseases:Epilepsy
Disease related genes
Predicted intracellular proteins

Transmembrane

737..757; Helical

Transmembrane Count

Ensembl

ENSG00000008277

Entrez Gene Symbol

ADAM22

Supporting publications (n)

EVMP confidence score

0.25

Fluorescence & Localization3

Tissue Specificadipose tissueCell SpecificAdipocytesSingle-Nuclei Brain Specificastrocyte

Function & Pathway6

Protein Function (3)

Human disease related genes:Nervous system diseases:Epilepsy
Disease related genes
Predicted intracellular proteins

Cellular Component (4)

Molecular Function (3)

Biological Process (3)

Reactome

R-hsa-5682910 lgi adam interactions

Mediation Categories

Adhesion and uptake mediation

Relations & Evidence24

Ligand-Receptor Signaling (23)

23 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
cell_surface	cell_surface	connectomeDB2020	No	No	No	Yes	No
cell_surface	cell_surface	OmniPath	No	No	No	Yes	No
transmembrane	transmembrane_predicted	Phobius	No	No	No	Yes	No

Page 3 of 3Previous

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry	2	38343172 32002171

Sequence, Structure & Domains12

Sequences

Length

906

Mass

100,433

Sequence

MQAAVAVSVPFLLLCVLGTCPPARCGQAGDASLMELEKRKENRFVERQSIVPLRLIYRSGGEDESRHDALDTRVRGDLGGPQLTHVDQASFQVDAFGTSFILDVVLNHDLLSSEYIERHIEHGGKTVEVKGGEHCYYQGHIRGNPDSFVALSTCHGLHGMFYDGNHTYLIEPEENDTTQEDFHFHSVYKSRLFEFSLDDLPSEFQQVNITPSKFILKPRPKRSKRQLRRYPRNVEEETKYIELMIVNDHLMFKKHRLSVVHTNTYAKSVVNMADLIYKDQLKTRIVLVAMETWATDNKFAISENPLITLREFMKYRRDFIKEKSDAVHLFSGSQFESSRSGAAYIGGICSLLKGGGVNEFGKTDLMAVTLAQSLAHNIGIISDKRKLASGECKCEDTWSGCIMGDTGYYLPKKFTQCNIEEYHDFLNSGGGACLFNKPSKLLDPPECGNGFIETGEECDCGTPAECVLEGAECCKKCTLTQDSQCSDGLCCKKCKFQPMGTVCREAVNDCDIRETCSGNSSQCAPNIHKMDGYSCDGVQGICFGGRCKTRDRQCKYIWGQKVTASDKYCYEKLNIEGTEKGNCGKDKDTWIQCNKRDVLCGYLLCTNIGNIPRLGELDGEITSTLVVQQGRTLNCSGGHVKLEEDVDLGYVEDGTPCGPQMMCLEHRCLPVASFNFSTCLSSKEGTICSGNGVCSNELKCVCNRHWIGSDCNTYFPHNDDAKTGITLSGNGVAGTNIIIGIIAGTILVLALILGITAWGYKNYREQRQLPQGDYVKKPGDGDSFYSDIPPGVSTNSASSSKKRSNGLSHSWSERIPDTKHISDICENGRPRSNSWQGNLGGNKKKIRGKRFRPRSNSTETLSPAKSPSSSTGSIASSRKYPYPMPPLPDEDKKVNRQSARLWETSI

Alternative Products

Event=Alternative splicing; Named isoforms=5; Name=1; Synonyms=Epsilon; IsoId=Q9P0K1-1; Sequence=Displayed; Name=2; Synonyms=Delta; IsoId=Q9P0K1-2; Sequence=VSP_005482, VSP_005484; Name=3; Synonyms=Alpha; IsoId=Q9P0K1-3; Sequence=VSP_005483; Name=4; Synonyms=Beta; IsoId=Q9P0K1-4; Sequence=VSP_005482, VSP_005483; Name=5; IsoId=Q9P0K1-5; Sequence=VSP_005482

Alternative Sequence

768..803; Missing (in isoform 2, isoform 4 and isoform 5); 859; E -> EYLNPWFKRDYNVAKWVEDVNKNTEGPYFR (in isoform 2); 860..906; Missing (in isoform 3 and isoform 4)

3D Structural Models

Turn

254..257; 351..353; 467..473; 536..539; 574..576

Helix

249..253; 259..280; 305..318; 363..378; 384..389; 416..427; 432..435; 463..466; 550..558; 567..573; 595..597; 671..674; 688..690

Beta Strand

235..237; 239..247; 281..292; 294..296; 325..333; 336..338; 341..343; 354..359; 390..392; 397..399; 449..451; 474..479; 486..488; 491..496; 502..504; 507..511; 540..543; 546..548; 578..581; 585..590; 600..602; 605..607; 613..617; 622..628; 631..637; 640..645; 646..648; 656..658; 661..666; 668..670; 692..695; 700..702; 706..708

3D Structure

Electron microscopy (2); X-ray crystallography (8)

Domain & Motif Annotations

Compositional Bias

793..810; Low complexity; 811..829; Basic and acidic residues; 842..853; Basic residues; 862..877; Low complexity

Domain (FT)

239..438; Peptidase M12B; 444..531; Disintegrin; 675..712; EGF-like

Region

785..906; Disordered

Supporting Publications3

PMID	Title	Abstract
28986585	Quantitation of putative colorectal cancer biomarker candidates in serum extracellular vesicles by targeted proteomics.	No abstract available
37786918	Rapid and in-depth proteomic profiling of small extracellular vesicles for ultralow samples.	No abstract available
38321535	Identification of specific markers for human pluripotent stem cell-derived small extracellular vesicles.	No abstract available