Protein detail
HCST
Hematopoietic cell signal transducer (DNAX-activation protein 10) (Membrane protein DAP10) (Transmembrane adapter protein KAP10)
Entry name HCST | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 5 | Transmembrane count 1 | Protein classification Predicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information12
Protein Names
Hematopoietic cell signal transducer (DNAX-activation protein 10) (Membrane protein DAP10) (Transmembrane adapter protein KAP10)
Protein Class
Predicted membrane proteins
Transmembrane
49..69; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (4)
DAP10DKFZP586C1522KAP10PIK3AP
Gene Description
Hematopoietic cell signal transducer
Chromosome
19
Position
35902529-35904377
Supporting publications (n)
5
EVMP confidence score
0.50
Fluorescence & Localization2
Cell SpecificEsophageal apical cells
Function & Pathway6
Cellular Component (2)
Molecular Function (4)
Biological Process (3)
Reactome (2)
Mediation Categories (2)
Immune mediationReceptor-signaling mediation
Relations & Evidence25
Ligand-Receptor Signaling (24)
24 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | No | Yes | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | Yes | No |
| transmembrane | transmembrane | CellPhoneDB | No | No | No | Yes | No |
| transmembrane | transmembrane | LOCATE | No | No | No | Yes | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | Yes | No |
| transmembrane | transmembrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | Cellinker | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | Yes | No |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Mass spectrometry | 0 |
Sequence, Structure & Domains8
Sequences
Length
93
Mass
9,489
Sequence
MIHLGHILFLLLLPVAAAQTTPGERSSLPAFYPGTSGSCSGCGSLSLPLLAGLVAADAVASLLIVGAVFLCARPRRSPAQEDGKVYINMPGRG
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9UBK5-1; Sequence=Displayed; Name=2; IsoId=Q9UBK5-2; Sequence=VSP_033022
Alternative Sequence
81; Missing (in isoform 2)
Domain & Motif Annotations
Region
86..89; PIK3R1 binding site; 86..88; GRB2 binding site
Protein Families
DAP10 family
Sequence Similarities
Belongs to the DAP10 family.
Supporting Publications5
| PMID | Title | Abstract |
|---|---|---|
| 23585444 | Identification and characterization of proteins isolated from microvesicles derived from human lung cancer pleural effusions. | No abstract available |
| 26801919 | Exosomes Secreted by Apoptosis-Resistant Acute Myeloid Leukemia (AML) Blasts Harbor Regulatory Network Proteins Potentially Involved in Antagonism of Apoptosis. | No abstract available |
| 27723984 | Proteomic and Bioinformatic Characterization of Extracellular Vesicles Released from Human Macrophages upon Influenza A Virus Infection. | No abstract available |
| 38731868 | The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer. | No abstract available |
| 40091455 | Potential Role of Menstrual Fluid-Derived Small Extracellular Vesicle Proteins in Endometriosis Pathogenesiss. | No abstract available |