Protein detail
ZO2
Tight junction protein 2 (Tight junction protein ZO-2) (Zona occludens protein 2) (Zonula occludens protein 2)
Entry name ZO2 | UniProt ID | EVMP score 0.50 |
Frequency 1 | Transmembrane count | Protein classification Cancer-related genesDisease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteins |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Tight junction protein 2 (Tight junction protein ZO-2) (Zona occludens protein 2) (Zonula occludens protein 2)
Protein Class
Cancer-related genesDisease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteins
Protein Function
- Cancer-related genes:Mutational cancer driver genes
- Predicted intracellular proteins
- Human disease related genes:Congenital disorders of metabolism:Congenital disorders of ion transport and metabolism
- Human disease related genes:Digestive system diseases:Liver diseases
- Disease related genes
Ensembl
Entrez Gene Symbol
Gene Synonym
DFNA51X104ZO-2ZO2
Gene Description
Tight junction protein 2
Chromosome
9
Position
69121264-69274615
Frequency
1
EVMP Score
0.50
Fluorescence & Localization
Function & Pathway
Protein Function
- Cancer-related genes:Mutational cancer driver genes
- Predicted intracellular proteins
- Human disease related genes:Congenital disorders of metabolism:Congenital disorders of ion transport and metabolism
- Human disease related genes:Digestive system diseases:Liver diseases
- Disease related genes
Cellular Component
Molecular Function
- GO:0004385 guanylate kinase activity
- GO:0005515 protein binding
- GO:0019904 protein domain specific binding
- GO:0030674 protein-macromolecule adaptor activity
- GO:0044325 transmembrane transporter binding
- GO:0045296 cadherin binding
- GO:0050839 cell adhesion molecule binding
- GO:1990782 protein tyrosine kinase binding
Biological Process
Reactome
- R-hsa-109581 apoptosis
- R-hsa-111465 apoptotic cleavage of cellular proteins
- R-hsa-351906 apoptotic cleavage of cell adhesion proteins
- R-hsa-75153 apoptotic execution phase
- R-hsa-5357801 programmed cell death
- R-hsa-8980692 rhoa gtpase cycle
- R-hsa-9013026 rhob gtpase cycle
- R-hsa-9013106 rhoc gtpase cycle
- R-hsa-9012999 rho gtpase cycle
- R-hsa-2028269 signaling by hippo
- R-hsa-9716542 signaling by rho gtpases miro gtpases and rhobtb3
Mediation Categories
Adhesion and uptake mediationFusion and delivery mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
15 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| TJP2 | EGF | P01133 | S | 168 | phosphorylation | BEL-Large-Corpus_ProtMapperProtMapper | ProtMapper:17081983 |
| TJP2 | AKT1 | P31749 | S | 244 | phosphorylation | KEA | KEA:17570479 |
| TJP2 | CDK2 | P24941 | S | 174 | phosphorylation | KEA | KEA:17570479 |
| TJP2 | CDK2 | P24941 | S | 266 | phosphorylation | KEA | KEA:17570479 |
| TJP2 | CDK2 | P24941 | S | 296 | phosphorylation | KEA | KEA:17570479 |
| TJP2 | CSNK1D | P48730 | S | 170 | phosphorylation | KEA | KEA:17570479 |
| TJP2 | CSNK1E | P49674 | S | 1,159 | phosphorylation | KEA | KEA:17570479 |
| TJP2 | GSK3B | P49841 | S | 107 | phosphorylation | KEA | KEA:17570479 |
| TJP2 | GSK3B | P49841 | S | 266 | phosphorylation | KEA | KEA:17570479 |
| TJP2 | GSK3B | P49841 | S | 296 | phosphorylation | KEA | KEA:17570479 |
Page 1 of 2Next
Ligand-Receptor Signaling
17 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | No | No | No |
| adhesion | adhesion | OmniPath | Yes | Yes | No | No | No |
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | No | No | No |
| tight_junction | tight_junction | GO_Intercell | Yes | Yes | No | No | No |
| tight_junction | tight_junction | OmniPath | Yes | Yes | No | No | No |
Page 1 of 2Next
Regulatory Interaction Network
3 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| ZO2 | Q9UDY2 | WWTR1 | Q9GZV5 | Yes | No | Yes | LMPIDSIGNOR | LMPID:20850437SIGNOR:21808241 |
| ZO2 | Q9UDY2 | ARVC | O00192 | Yes | No | Yes | SIGNOR | SIGNOR:15456900 |
| ZO2 | Q9UDY2 | YAP1 | P46937 | Yes | No | Yes | ELMLMPIDSIGNOR | LMPID:20868367SIGNOR:23829894ELM:20868367 |
Protein Complex Composition
6 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| PPIP5K2TJP2 | O43314Q9UDY2 | 0:0 | hu.MAP | |||
| TJP1TJP2TPM3 | P06753Q07157Q9UDY2 | 0:0:0 | hu.MAP | |||
| ESRRATJP2UBN1WDR36ZMYM3ZNF606 | P11474Q14202Q8NI36Q8WXB4Q9NPG3Q9UDY2 | 0:0:0:0:0:0 | Havugimana2012 | Havugimana2012:C_516 | ||
| MAGIXTJP1TJP2 | Q07157Q9H6Y5Q9UDY2 | 0:0:0 | hu.MAP2 | |||
| TJP1TJP2 | Q07157Q9UDY2 | 0:0 | hu.MAPhu.MAP2 | |||
| TJP2 | Q9UDY2 | 2 | PDB | PDB:3e17PDB:2osg |
Sequence, Structure & Domains
Sequences
Length
1,190
Mass
133,958
Sequence
MPVRGDRGFPPRRELSGWLRAPGMEELIWEQYTVTLQKDSKRGFGIAVSGGRDNPHFENGETSIVISDVLPGGPADGLLQENDRVVMVNGTPMEDVLHSFAVQQLRKSGKVAAIVVKRPRKVQVAALQASPPLDQDDRAFEVMDEFDGRSFRSGYSERSRLNSHGGRSRSWEDSPERGRPHERARSRERDLSRDRSRGRSLERGLDQDHARTRDRSRGRSLERGLDHDFGPSRDRDRDRSRGRSIDQDYERAYHRAYDPDYERAYSPEYRRGARHDARSRGPRSRSREHPHSRSPSPEPRGRPGPIGVLLMKSRANEEYGLRLGSQIFVKEMTRTGLATKDGNLHEGDIILKINGTVTENMSLTDARKLIEKSRGKLQLVVLRDSQQTLINIPSLNDSDSEIEDISEIESNRSFSPEERRHQYSDYDYHSSSEKLKERPSSREDTPSRLSRMGATPTPFKSTGDIAGTVVPETNKEPRYQEDPPAPQPKAAPRTFLRPSPEDEAIYGPNTKMVRFKKGDSVGLRLAGGNDVGIFVAGIQEGTSAEQEGLQEGDQILKVNTQDFRGLVREDAVLYLLEIPKGEMVTILAQSRADVYRDILACGRGDSFFIRSHFECEKETPQSLAFTRGEVFRVVDTLYDGKLGNWLAVRIGNELEKGLIPNKSRAEQMASVQNAQRDNAGDRADFWRMRGQRSGVKKNLRKSREDLTAVVSVSTKFPAYERVLLREAGFKRPVVLFGPIADIAMEKLANELPDWFQTAKTEPKDAGSEKSTGVVRLNTVRQIIEQDKHALLDVTPKAVDLLNYTQWFPIVIFFNPDSRQGVKTMRQRLNPTSNKSSRKLFDQANKLKKTCAHLFTATINLNSANDSWFGSLKDTIQHQQGEAVWVSEGKMEGMDDDPEDRMSYLTAMGADYLSCDSRLISDFEDTDGEGGAYTDNELDEPAEEPLVSSITRSSEPVQHEESIRKPSPEPRAQMRRAASSDQLRDNSPPPAFKPEPPKAKTQNKEESYDFSKSYEYKSNPSAVAGNETPGASTKGYPPPVAAKPTFGRSILKPSTPIPPQEGEEVGESSEEQDNAPKSVLGKVKIFEKMDHKARLQRMQELQEAQNARIEIAQKHPDIYAVPIKTHKPDPGTPQHTSSRPPEPQKAPSRPYQDTRGSYGSDAEEEEYRQQLSEHSKRGYYGQSARYRDTEL
Alternative Products
Event=Alternative promoter usage, Alternative splicing; Named isoforms=7; Name=A1; IsoId=Q9UDY2-1; Sequence=Displayed; Name=A2; IsoId=Q9UDY2-2; Sequence=VSP_003149; Name=A3; IsoId=Q9UDY2-5; Sequence=VSP_007835, VSP_007836; Name=C1; IsoId=Q9UDY2-3; Sequence=VSP_006953; Name=C2; IsoId=Q9UDY2-4; Sequence=VSP_006953, VSP_003149; Name=6; IsoId=Q9UDY2-6; Sequence=VSP_046115, VSP_046116; Name=7; IsoId=Q9UDY2-7; Sequence=VSP_046114
Alternative Sequence
1..23; Missing (in isoform C1 and isoform C2); 1..20; MPVRGDRGFPPRRELSGWLR -> MKTAQALHRMWIQAVKKLRRWKGRVSPSASSPLVFPNLSSWEGEGSKTILT (in isoform 7); 1..19; MPVRGDRGFPPRRELSGWL -> MKTAQALHRMWIQAVKKLRRWKG (in isoform 6); 961..1107; Missing (in isoform A2 and isoform C2); 961..997; Missing (in isoform 6); 961..993; SIRKPSPEPRAQMRRAASSDQLRDNSPPPAFKP -> VRRGRPRAGTGEPGVFLALSWTAVCSGCCGRHS (in isoform A3); 994..1190; Missing (in isoform A3)
3D Structural Models
Turn
373..375
Helix
337..341; 363..372
Beta Strand
306..311; 315..317; 321..332; 349..353; 376..381
3D Structure
NMR spectroscopy (1); X-ray crystallography (1)
Domain & Motif Annotations
Compositional Bias
169..291; Basic and acidic residues; 415..446; Basic and acidic residues; 956..967; Basic and acidic residues; 994..1014; Basic and acidic residues; 1060..1072; Acidic residues; 1166..1175; Basic and acidic residues
Domain (FT)
33..120; PDZ 1; 307..385; PDZ 2; 509..590; PDZ 3; 604..669; SH3; 678..876; Guanylate kinase-like
Region
152..306; Disordered; 408..506; Disordered; 920..1079; Disordered; 1105..1190; Disordered; 1188..1190; Interaction with SCRIB
Protein Families
MAGUK family
Sequence Similarities
Belongs to the MAGUK family.
Clinical Relevance
Disease Involvement
Cancer-related genesDisease variantIntrahepatic cholestasis
Interaction Protein
ENSG00000104067ENSG00000118193ENSG00000134308ENSG00000164924ENSG00000166913ENSG00000170027ENSG00000180900ENSG00000247077
Interaction Count
8
Interaction Dataset
biogrid_opencellintact_biogridintact_biogrid_opencell