Protein detail

SMPX

Small muscular protein (Stretch-responsive skeletal muscle protein)

Entry name SMPX	UniProt ID Q9UHP9	EVMP confidence score 0.38
Supporting publications (n) 1	Transmembrane count	Protein classification

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information6

Protein Names

Small muscular protein (Stretch-responsive skeletal muscle protein)

Protein Function (4)

Disease related genes
Human disease related genes:Nervous system diseases:Ear disease
Predicted intracellular proteins
Human disease related genes:Musculoskeletal diseases:Muscular diseases

Ensembl

ENSG00000091482

Entrez Gene Symbol

SMPX

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization4

Tissue SpecificintestineCell SpecificEnterocytesSingle-Nuclei Brain Specificependymal cell

Function & Pathway4

Protein Function (4)

Disease related genes
Human disease related genes:Nervous system diseases:Ear disease
Predicted intracellular proteins
Human disease related genes:Musculoskeletal diseases:Muscular diseases

Cellular Component (4)

Biological Process (3)

Mediation Categories

Other mediation

Relations & Evidence6

Ligand-Receptor Signaling (5)

5 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
adhesion_cytoskeleton_adaptor	intracellular_intercellular_related	Adhesome	Yes	No	No	No	No
intracellular_intercellular_related	intracellular_intercellular_related	OmniPath	Yes	No	No	No	No

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometryWestern blottingELISA	5	38225453 39873726 26775013 33580265 38164498

Sequence, Structure & Domains6

Sequences

Length

Mass

9,559

Sequence

MNMSKQPVSNVRAIQANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQ

Domain & Motif Annotations

Region

22..66; Disordered

Protein Families

SMPX family

Sequence Similarities

Belongs to the SMPX family.

Supporting Publications1

PMID	Title	Abstract
37427430	Multiomics of Tissue Extracellular Vesicles Identifies Unique Modulators of Atherosclerosis and Calcific Aortic Valve Stenosis.	No abstract available