Protein detail
S12A6
Solute carrier family 12 member 6 (Electroneutral potassium-chloride cotransporter 3) (K-Cl cotransporter 3)
Entry name S12A6 | UniProt ID | EVMP confidence score 0.25 |
Supporting publications (n) 2 | Transmembrane count 12 | Protein classification Disease related genesHuman disease related genesMetabolic proteinsPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Solute carrier family 12 member 6 (Electroneutral potassium-chloride cotransporter 3) (K-Cl cotransporter 3)
Protein Class (7)
Disease related genesHuman disease related genesMetabolic proteinsPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function (5)
- Predicted intracellular proteins
- Human disease related genes:Nervous system diseases:Neurodegenerative diseases
- Potential drug targets
- Transporters:Electrochemical Potential-driven transporters
- Disease related genes
Transmembrane
136..158; Discontinuously helical; Name=1; 166..188; Helical; Name=2; 212..245; Helical; Name=3; 264..287; Helical; Name=4; 288..316; Helical; Name=5; 434..454; Helical; Name=6; 465..487; Helical; Name=7; 519..545; Helical; Name=8; 569..589; Helical; Name=9; 590..612; Helical; Name=10; 630..649; Helical; Name=11; 650..665; Helical; Name=12
Transmembrane Count
12
Ensembl
Entrez Gene Symbol
Gene Synonym (4)
ACCPNKCC3KCC3AKCC3B
Gene Description
Solute carrier family 12 member 6
Chromosome
15
Position
34229784-34338060
Supporting publications (n)
2
EVMP confidence score
0.25
Fluorescence & Localization3
Tissue SpecificliverCell SpecificAlveolar cells type 1Single-Nuclei Brain Specificpericyte
Function & Pathway6
Protein Function (5)
- Predicted intracellular proteins
- Human disease related genes:Nervous system diseases:Neurodegenerative diseases
- Potential drug targets
- Transporters:Electrochemical Potential-driven transporters
- Disease related genes
Cellular Component (5)
Molecular Function (4)
Biological Process (3)
Reactome (6)
Mediation Categories (3)
Clinical-translation mediationFusion and delivery mediationMetabolism mediation
Relations & Evidence46
Enzyme-Mediated Modification (10)
10 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| SLC12A6 | WNK3 | Q9BYP7 | S | 96 | phosphorylation | SIGNORPhosphoSitePhosphoSite_ProtMapperProtMapper | SIGNOR:24043619 |
| SLC12A6 | WNK3 | Q9BYP7 | T | 1,048 | phosphorylation | SIGNORPhosphoSitePhosphoSite_ProtMapperProtMapper | SIGNOR:24043619 |
| SLC12A6 | WNK3 | Q9BYP7 | T | 991 | phosphorylation | SIGNORPhosphoSitePhosphoSite_ProtMapperProtMapper | SIGNOR:24043619 |
| SLC12A6 | WNK1 | Q9H4A3 | T | 1,048 | phosphorylation | PhosphoSite_MIMPMIMPSIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:19665974ProtMapper:19665974 |
| SLC12A6 | WNK1 | Q9H4A3 | T | 991 | phosphorylation | PhosphoSite_MIMPMIMPSIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:19665974ProtMapper:19665974 |
| SLC12A6 | STK39 | Q9UEW8 | T | 1,048 | phosphorylation | ProtMapperRLIMS-P_ProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:27782176 |
| SLC12A6 | STK39 | Q9UEW8 | S | 96 | phosphorylation | Sparser_ProtMapperProtMapperREACH_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:24043619 |
| SLC12A6 | STK39 | Q9UEW8 | T | 991 | phosphorylation | RLIMS-P_ProtMapperREACH_ProtMapperProtMapper | ProtMapper:27782176 |
| SLC12A6 | STK39 | Q9UEW8 | T | 160 | phosphorylation | PhosphoSite_ProtMapperProtMapper | |
| SLC12A6 | SRM | P19623 | T | 1,048 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:27782176 |
Ligand-Receptor Signaling (30)
30 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| basolateral_cell_membrane | plasma_membrane | UniProt_location | No | No | No | Yes | No |
| basolateral_cell_membrane | plasma_membrane | Ramilowski_location | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | Ramilowski_location | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | CSPA | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | No | No | No | Yes | No |
| cell_surface | cell_surface | Surfaceome | No | No | No | Yes | No |
| cell_surface | cell_surface | OmniPath | No | No | No | Yes | No |
| receptor | receptor | scConnect | No | Yes | No | Yes | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | No | Yes | No |
Page 3 of 3Previous
Regulatory Interaction Network (3)
3 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| WNK3 | Q9BYP7 | S12A6 | Q9UHW9 | Yes | No | Yes | iPTMnetSIGNORProtMapperSIGNOR_ProtMapperPhosphoSite_ProtMapper | ProtMapper:24043619SIGNOR:24043619SIGNOR:21613606 |
| STK39 | Q9UEW8 | S12A6 | Q9UHW9 | Yes | No | Yes | Sparser_ProtMapperPhosphoSite_norefPhosphoPointSIGNORProtMapperiPTMnetHPRDRLIMS-P_ProtMapperREACH_ProtMapperPhosphoSite_ProtMapper | ProtMapper:24043619SIGNOR:24043619ProtMapper:27782176HPRD:12386165 |
| WNK1 | Q9H4A3 | S12A6 | Q9UHW9 | Yes | No | Yes | PhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | PhosphoSite:27782176PhosphoSite:19665974SIGNOR:19665974PhosphoSite:24043619ProtMapper:19665974PhosphoSite:24393035PhosphoSite:27485015 |
Protein Complex Composition (2)
Sequence, Structure & Domains14
Sequences
Length
1,150
Mass
127,617
Sequence
MHPPETTTKMASVRFMVTPTKIDDIPGLSDTSPDLSSRSSSRVRFSSRESVPETSRSEPMSEMSGATTSLATVALDPPSDRTSHPQDVIEDLSQNSITGEHSQLLDDGHKKARNAYLNNSNYEEGDEYFDKNLALFEEEMDTRPKVSSLLNRMANYTNLTQGAKEHEEAENITEGKKKPTKTPQMGTFMGVYLPCLQNIFGVILFLRLTWVVGTAGVLQAFAIVLICCCCTMLTAISMSAIATNGVVPAGGSYFMISRALGPEFGGAVGLCFYLGTTFAAAMYILGAIEIFLVYIVPRAAIFHSDDALKESAAMLNNMRVYGTAFLVLMVLVVFIGVRYVNKFASLFLACVIVSILAIYAGAIKSSFAPPHFPVCMLGNRTLSSRHIDVCSKTKEINNMTVPSKLWGFFCNSSQFFNATCDEYFVHNNVTSIQGIPGLASGIITENLWSNYLPKGEIIEKPSAKSSDVLGSLNHEYVLVDITTSFTLLVGIFFPSVTGIMAGSNRSGDLKDAQKSIPIGTILAILTTSFVYLSNVVLFGACIEGVVLRDKFGDAVKGNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHSKANGEPTWALLLTAAIAELGILIASLDLVAPILSMFFLMCYLFVNLACALQTLLRTPNWRPRFRYYHWALSFMGMSICLALMFISSWYYAIVAMVIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARFALLRLEEGPPHTKNWRPQLLVLLKLDEDLHVKHPRLLTFASQLKAGKGLTIVGSVIVGNFLENYGEALAAEQTIKHLMEAEKVKGFCQLVVAAKLREGISHLIQSCGLGGMKHNTVVMGWPNGWRQSEDARAWKTFIGTVRVTTAAHLALLVAKNISFFPSNVEQFSEGNIDVWWIVHDGGMLMLLPFLLKQHKVWRKCSIRIFTVAQLEDNSIQMKKDLATFLYHLRIEAEVEVVEMHDSDISAYTYERTLMMEQRSQMLRHMRLSKTERDREAQLVKDRNSMLRLTSIGSDEDEETETYQEKVHMTWTKDKYMASRGQKAKSMEGFQDLLNMRPDQSNVRRMHTAVKLNEVIVNKSHEAKLVLLNMPGPPRNPEGDENYMEFLEVLTEGLERVLLVRGGGSEVITIYS
Alternative Products
Event=Alternative promoter usage, Alternative splicing; Named isoforms=6; Name=1; Synonyms=KCC3a; IsoId=Q9UHW9-1; Sequence=Displayed; Name=2; Synonyms=KCC3b; IsoId=Q9UHW9-2; Sequence=VSP_006115, VSP_006116; Name=3; Synonyms=KCC3a-X2M; IsoId=Q9UHW9-3; Sequence=VSP_041389; Name=4; Synonyms=KCC3a-S3; IsoId=Q9UHW9-4; Sequence=VSP_041388; Name=5; Synonyms=KCC3a-S, KCC3a-S1, KCC3a-S2; IsoId=Q9UHW9-5; Sequence=VSP_041387; Name=6; Synonyms=KCC3b-X2M; IsoId=Q9UHW9-6; Sequence=VSP_006115, VSP_006116, VSP_041389
Alternative Sequence
1..59; Missing (in isoform 5); 1..51; Missing (in isoform 2 and isoform 6); 1..9; Missing (in isoform 4); 52..90; PETSRSEPMSEMSGATTSLATVALDPPSDRTSHPQDVIE -> MPHFTVTKVEDPEEGAAASISQEPSLADIKARIQDSDEP (in isoform 2 and isoform 6); 91..105; Missing (in isoform 3 and isoform 6)
3D Structural Models
Turn
242..244; 262..264; 266..268; 293..295; 365..367; 422..424; 553..557; 600..602; 697..699; 800..802; 862..866; 935..938; 966..968; 980..982; 991..993; 1081..1087; 1129..1131
Helix
168..170; 178..181; 187..190; 192..199; 202..206; 208..213; 216..241; 252..259; 269..292; 312..335; 338..342; 344..364; 404..408; 442..445; 485..492; 493..495; 499..503; 506..508; 512..541; 544..547; 550..552; 560..564; 570..599; 605..610; 621..635; 639..666; 681..696; 701..723; 729..745; 775..784; 804..820; 835..844; 872..885; 896..898; 920..930; 954..965; 984..987; 994..1001; 1015..1019; 1088..1098; 1118..1128
Beta Strand
165..167; 306..308; 373..377; 380..382; 390..393; 395..400; 409..411; 425..427; 429..434; 438..440; 446..448; 461..463; 474..476; 509..511; 565..567; 746..748; 759..762; 769..772; 790..798; 825..834; 847..852; 854..859; 867..869; 889..895; 910..915; 932..934; 940..947; 949..951; 971..977; 988..990; 1002..1004; 1008..1010; 1104..1107; 1113..1116; 1133..1139
3D Structure
Electron microscopy (8)
Domain & Motif Annotations
Compositional Bias
28..45; Low complexity; 163..177; Basic and acidic residues
Domain (CC)
[Isoform 2]: N-terminal loop binds to the intracellular vestibule of the transporter, arresting the transporter in an inhibited state.
Region
20..66; Disordered; 161..181; Disordered; 682..691; Scissor helix; 1133..1150; Interaction with CKB
Protein Families (2)
- SLC12A transporter family
- K/Cl co-transporter subfamily
Sequence Similarities
Belongs to the SLC12A transporter family. K/Cl co-transporter subfamily.
Clinical Relevance5
Disease Involvement (4)
Charcot-Marie-Tooth diseaseDisease variantNeurodegenerationNeuropathy
Antibody
Interaction Protein
ENSG00000198648
Interaction Count
1
Interaction Dataset
intact_biogrid
Supporting Publications2
| PMID | Title | Abstract |
|---|---|---|
| 32002171 | Activated human astrocyte-derived extracellular vesicles modulate neuronal uptake, differentiation and firing. | No abstract available |
| 38343172 | Analysis of secreted small extracellular vesicles from activated human microglial cell lines reveals distinct pro- and anti-inflammatory proteomic profiles. | No abstract available |