Protein detail
SLAF5
SLAM family member 5 (Cell surface antigen MAX.3) (Hly9-beta) (Leukocyte differentiation antigen CD84) (Signaling lymphocytic activation molecule 5) (CD antigen CD84)
Entry name SLAF5 | UniProt ID | EVMP confidence score 0.63 |
Supporting publications (n) 8 | Transmembrane count 1 | Protein classification CD markersPredicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
SLAM family member 5 (Cell surface antigen MAX.3) (Hly9-beta) (Leukocyte differentiation antigen CD84) (Signaling lymphocytic activation molecule 5) (CD antigen CD84)
Protein Class (2)
CD markersPredicted membrane proteins
Protein Function
CD markers
Transmembrane
226..246; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
hCD84mCD84SLAMF5
Gene Description
CD84 molecule
Chromosome
1
Position
160541095-160579516
Supporting publications (n)
8
EVMP confidence score
0.63
Fluorescence & Localization
Tissue Specificskeletal muscleCell SpecificMyonuclei
Function & Pathway
Protein Function
CD markers
Cellular Component (3)
Molecular Function (2)
Biological Process (3)
Mediation Categories (3)
Adhesion and uptake mediationFusion and delivery mediationImmune mediation
Relations & Evidence43
Enzyme-Mediated Modification (1)
1 record.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| CD84 | LYN | P07948 | Y | 279 | phosphorylation | Sparser_ProtMapperProtMapper | ProtMapper:22068234 |
Ligand-Receptor Signaling (40)
40 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | ICELLNET | Yes | Yes | |||
| slam | receptor | ICELLNET | Yes | Yes | |||
| receptor | receptor | OmniPath | Yes | Yes | |||
| extracellular | extracellular | DGIdb | Yes | ||||
| extracellular | extracellular | OmniPath | Yes | ||||
| intracellular | intracellular | LOCATE | Yes | ||||
| intracellular | intracellular | OmniPath | Yes | ||||
| cell_surface_ligand | cell_surface_ligand | connectomeDB2020 | Yes | Yes | |||
| cell_surface_ligand | cell_surface_ligand | OmniPath | Yes | Yes | |||
| ig_like | cell_adhesion | HGNC | Yes | Yes | Yes |
Page 1 of 4Next
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry | 1 | 35988891 |
Sequence, Structure & Domains
Sequences
Length
345
Mass
38,782
Sequence
MAQHHLWILLLCLQTWPEAAGKDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRTHHTGLLSVLAMFFLLVLILSSVFLFRLFKRRQGRIFPEGSCLNTFTKNPYAASKKTIYTYIMASRNTQPAESRIYDEILQSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTSSYEIVI
Alternative Products
Event=Alternative splicing; Named isoforms=7; Name=1; Synonyms=CD84a; IsoId=Q9UIB8-1; Sequence=Displayed; Name=2; Synonyms=CD84b; IsoId=Q9UIB8-2; Sequence=VSP_020852; Name=3; Synonyms=CD84c; IsoId=Q9UIB8-3; Sequence=VSP_020851; Name=4; Synonyms=CD84e; IsoId=Q9UIB8-4; Sequence=VSP_020854, VSP_020856; Name=5; Synonyms=CD84d; IsoId=Q9UIB8-5; Sequence=VSP_020853, VSP_020855; Name=6; Synonyms=CD84s; IsoId=Q9UIB8-6; Sequence=VSP_020849, VSP_020850; Name=7; IsoId=Q9UIB8-7; Sequence=VSP_020848, VSP_020851
Alternative Sequence
16..130; WPEAAGKDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYR -> C (in isoform 7); 214..241; DIAMGFRTHHTGLLSVLAMFFLLVLILS -> GNQLCPSLLVSLRDHSEELQGLNVGHIL (in isoform 6); 242..345; Missing (in isoform 6); 254..271; GRIFPEGSCLNTFTKNPY -> D (in isoform 3 and isoform 7); 254..259; Missing (in isoform 2); 255..272; RIFPEGSCLNTFTKNPYA -> ASLQGRASEHSLFRSAVC (in isoform 5); 261..280; SCLNTFTKNPYAASKKTIYT -> KMWKLTFSPPGTEAIYPRFS (in isoform 4); 273..345; Missing (in isoform 5); 281..345; Missing (in isoform 4)
3D Structural Models
Turn
89..91
Helix
79..81; 101..103
Beta Strand
27..32; 37..39; 49..64; 68..70; 73..76; 85..87; 94..96; 105..115; 118..129
3D Structure
X-ray crystallography (1)
Domain & Motif Annotations
Compositional Bias
328..345; Polar residues
Motif
277..282; ITSM 1; 314..319; ITSM 2
Domain (CC)
The ITSMs (immunoreceptor tyrosine-based switch motifs) with the consensus sequence T-X-Y-X-X-[VI] present in SLAM family receptors have overlapping specificity for activating and inhibitory SH2 domain-containingbinding partners. Especially they mediate the interaction with the SH2 domain of SH2D1A and SH2D1B. A 'three-pronged' mechanism is proposed involving threonine (position -2), phosphorylated tyrosine (position 0) and valine/isoleucine (position +3).
Domain (FT)
26..129; Ig-like V-type; 135..207; Ig-like C2-type
Region
326..345; Disordered
Clinical Relevance
Drugs
Supporting Publications8
| PMID | Title | Related sentences |
|---|---|---|
| 30950185 | Unique Protein Profiles of Extracellular Vesicles as Diagnostic Biomarkers for Early and Advanced Non-Small Cell Lung Cancer. | No related sentences available |
| 32111925 | Rigorous characterization of urinary extracellular vesicles (uEVs) in the low centrifugation pellet - a neglected source for uEVs. | No related sentences available |
| 32759820 | Multiple Myeloma-Derived Extracellular Vesicles Induce Osteoclastogenesis through the Activation of the XBP1/IRE1α Axis. | No related sentences available |
| 32795414 | Extracellular Vesicle and Particle Biomarkers Define Multiple Human Cancers. | Among traditional exosome markers, CD9, HSPA8, ALIX, and HSP90AB1 represent pan-EVP markers, while ACTB, MSN, and RAP1B are novel pan-EVP markers. |
| 37507836 | Comparative proteomic analysis of three major extracellular vesicle classes secreted from human primary and metastatic colorectal cancer cells: Exosomes, microparticles, and shed midbody remnants. | No related sentences available |
| 39558134 | Serum small extracellular vesicles-derived BST2 as a biomarker for papillary thyroid microcarcinoma promotes lymph node metastasis. | No related sentences available |
| 39989284 | Altered proteomics in brain extracellular vesicles from depressed individuals who died by suicide implicates synaptic processes. | No related sentences available |
| 41216884 | Extracellular Vesicles From Multiple Sclerosis White Matter Exhibit Synaptic, Mitochondrial, Complement and Ageing-Related Pathway Dysregulation. | No related sentences available |